[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV56888.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:86 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   4->41 PF10439 * Bacteriocin_IIc 0.00043 21.1 38/65  
:HMM:PFM   39->51 PF11793 * FANCL_C 0.00069 61.5 13/70  

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV56888.1 GT:GENE ACV56888.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION complement(3419508..3419768) GB:FROM 3419508 GB:TO 3419768 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID ACV56888.1 GB:DB_XREF GI:257476568 LENGTH 86 SQ:AASEQ MNDSDKFQQLGLDDLEEVSGGEALSDRAVAALPKAVPGGICPYCGMKIAVSLYGTAFTNDHERFGFSNATVWQCNKSDLDYTLFRE GT:EXON 1|1-86:0| HM:PFM:NREP 2 HM:PFM:REP 4->41|PF10439|0.00043|21.1|38/65|Bacteriocin_IIc| HM:PFM:REP 39->51|PF11793|0.00069|61.5|13/70|FANCL_C| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 86-87| PSIPRED cccHHHHHHHcHHHHHHHcccccccHHHHHHHHHccccccccccccEEEEEEEEEcccccHHHccccccEEEEEccccccEEEEcc //