[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV56893.1
DDBJ      :             protein of unknown function nitrogen fixation
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:121 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   3->53 PF07862 * Nif11 2.1e-11 46.7 45/49  
:HMM:PFM   59->84 PF10439 * Bacteriocin_IIc 0.00076 46.2 26/65  
:REPEAT 2|76->92|93->109
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV56893.1 GT:GENE ACV56893.1 GT:PRODUCT protein of unknown function nitrogen fixation GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION complement(3425363..3425728) GB:FROM 3425363 GB:TO 3425728 GB:DIRECTION - GB:PRODUCT protein of unknown function nitrogen fixation GB:NOTE PFAM: protein of unknown function nitrogen fixation GB:PROTEIN_ID ACV56893.1 GB:DB_XREF GI:257476573 InterPro:IPR012903 LENGTH 121 SQ:AASEQ MNEQLKDFLKKASEDESIKDELKALEGLSAEENAEQAAAIARKAGFDLSAEDFAPSSAELDEDELGAVAGGEACCCQYTGLGLVNDRGAVCECPTTGTGIRRDTGEVCEITSICRFMGEVG GT:EXON 1|1-121:0| NREPEAT 1 REPEAT 2|76->92|93->109| SEG 30->44|aeenaeqaaaiarka| HM:PFM:NREP 2 HM:PFM:REP 3->53|PF07862|2.1e-11|46.7|45/49|Nif11| HM:PFM:REP 59->84|PF10439|0.00076|46.2|26/65|Bacteriocin_IIc| OP:NHOMO 3 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------3------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 111-114,116-122| PSIPRED ccHHHHHHHHHHcccHHHHHHHHHHHccccccccHHHHHHHHHHcccccHHHHHHHHHHccHHHHHHcccccccccccccccccccccEEEEcccccccccccHHHHHHHHHHHHHHHHcc //