[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV56933.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  3/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:277 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   20->97 PF10099 * RskA 8.3e-05 15.9 69/175  
:HMM:PFM   186->250 PF05887 * Trypan_PARP 6.5e-05 30.8 65/143  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV56933.1 GT:GENE ACV56933.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION complement(3469996..3470829) GB:FROM 3469996 GB:TO 3470829 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:NOTE KEGG: similar to novel pim oncogene GB:PROTEIN_ID ACV56933.1 GB:DB_XREF GI:257476613 LENGTH 277 SQ:AASEQ MKEDAAAIVDDAAKDDGAEASTEAERGKRRRERAEAKPRKKRWPLVVAGSVLLVVLLIVGGFSWDRWLRYDDAAEFQGEWQTHGTTAVVVIDGETIKLTEDVSWSYKLDTDAKTISYTFGNMEGSGRYRFSLDRSQLVISDGSGYTWLSTLADDIAWQFDQLVRAIQGQPQEEPPSGAGYTVLDRLSHDAEATPQRGEPVAPEPEPEPAAEPEPEAAPEPDPGDRQKPESDSASGPEDASASEAADEGGSASDAVDKNDDAAASGTRGVFDVSDLPA GT:EXON 1|1-277:0| TM:NTM 1 TM:REGION 44->66| SEG 4->18|daaaivddaakddga| SEG 23->42|eaergkrrreraeakprkkr| SEG 45->61|lvvagsvllvvllivgg| SEG 198->220|epvapepepepaaepepeaapep| SEG 229->254|esdsasgpedasaseaadeggsasda| HM:PFM:NREP 2 HM:PFM:REP 20->97|PF10099|8.3e-05|15.9|69/175|RskA| HM:PFM:REP 186->250|PF05887|6.5e-05|30.8|65/143|Trypan_PARP| OP:NHOMO 3 OP:NHOMOORG 3 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------111----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 17-17,20-20,25-25,39-39,45-45,48-48,53-53,67-67,73-74,76-76,81-82,87-87,90-90| PSIPRED ccccHHHHHHcccccccccccHHHHHHHHHHHHHHcccHHccccEEEEHHHHHHHHHHHccccHHHHcccccHHHccccccccccEEEEEEcccEEEEEcccccHHHccccccEEEEEEcccccccEEEEEEEEEEEEEEcccccHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHccccEEEEcccccc //