[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV56938.1
DDBJ      :             Acetamidase/Formamidase
Swiss-Prot:             

Homologs  Archaea  21/68 : Bacteria  140/915 : Eukaryota  52/199 : Viruses  0/175   --->[See Alignment]
b.23.3
:298 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   4->295 2ii1C PDBj 6e-45 39.6 %
:RPS:PDB   11->293 3b9tB PDBj 9e-20 23.9 %
:RPS:SCOP  7->291 2f4lA1  b.23.3.1 * 8e-72 37.7 %
:HMM:SCOP  1->292 2f4lA1 b.23.3.1 * 1.9e-81 38.5 %
:RPS:PFM   19->206 PF03069 * FmdA_AmdA 5e-26 43.5 %
:HMM:PFM   8->144 PF03069 * FmdA_AmdA 4.2e-24 28.5 137/369  
:HMM:PFM   148->292 PF03069 * FmdA_AmdA 1.1e-24 27.1 144/369  
:BLT:SWISS 16->201 AMDA_MYCSM 5e-12 38.9 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV56938.1 GT:GENE ACV56938.1 GT:PRODUCT Acetamidase/Formamidase GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION complement(3476821..3477717) GB:FROM 3476821 GB:TO 3477717 GB:DIRECTION - GB:PRODUCT Acetamidase/Formamidase GB:NOTE PFAM: Acetamidase/Formamidase; KEGG: bcb:BCB4264_A2569 acetamidase/formamidase family protein GB:PROTEIN_ID ACV56938.1 GB:DB_XREF GI:257476618 InterPro:IPR004304 LENGTH 298 SQ:AASEQ MQELNDERVLFAFARDLEPALTVASGETVRIRTQDCFGNQVQTPEDELDEIDWDRINPATGPVFVEGAVPGGALKVTIENIELDPQTASCTGKDEGVCGDRFDAWSTHLCAIDGDKLVWNDQLSIPLNPMIGVIGVAPAGDPVNCGTPGSHGGNMDNTAITTGATLYFPVAVEGALFGCGDMHAAMGDGEISVSGAEVAGYATVTLTALPDLHLVDPLIENGTHLGIIASAESLDAAADRAVHEMVDLLHDRTGVDEAELVMLLSLVADVQVCQMVDPQKTVRFMVPKYVLESLGFKL GT:EXON 1|1-298:0| BL:SWS:NREP 1 BL:SWS:REP 16->201|AMDA_MYCSM|5e-12|38.9|185/406| BL:PDB:NREP 1 BL:PDB:REP 4->295|2ii1C|6e-45|39.6|283/287| RP:PDB:NREP 1 RP:PDB:REP 11->293|3b9tB|9e-20|23.9|280/404| RP:PFM:NREP 1 RP:PFM:REP 19->206|PF03069|5e-26|43.5|177/209|FmdA_AmdA| HM:PFM:NREP 2 HM:PFM:REP 8->144|PF03069|4.2e-24|28.5|137/369|FmdA_AmdA| HM:PFM:REP 148->292|PF03069|1.1e-24|27.1|144/369|FmdA_AmdA| GO:PFM:NREP 2 GO:PFM GO:0008152|"GO:metabolic process"|PF03069|IPR004304| GO:PFM GO:0016811|"GO:hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in linear amides"|PF03069|IPR004304| RP:SCP:NREP 1 RP:SCP:REP 7->291|2f4lA1|8e-72|37.7|268/275|b.23.3.1| HM:SCP:REP 1->292|2f4lA1|1.9e-81|38.5|283/0|b.23.3.1|1/1|Acetamidase/Formamidase-like| OP:NHOMO 289 OP:NHOMOORG 213 OP:PATTERN 111---1111111111--------3---2-21----------------------11-----1--1--- 1-411--1-------------2---2------3222-2-1-1122-1-------------1----1--------------211-----------------------------------------------------11111----21------1-11----------111-------------2-------2--11111111-111111-1----111-1-----11111111-------------------------------------------------------------------------------------------1--------------------------------1-----1--111----1--211--------465---111--------------11211113--2-1--111-121111-2----122221-1--------1---------------------------------------1--------------------12--------22-3--1----2---2---1-23--1-----------------------------------------11-1-------------------------------------------1111-----------------------------1------------------------------------------------------------------------------------------1-1---1------------------1----------------------------------------------------------------------------------------------------------------1--11111--- ---------------2-1-1222111211111111112222221111233-1111111-111----------1-1---------------2-----------------4---------------------------------------------------------------------12----1----1--2------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 292 STR:RPRED 98.0 SQ:SECSTR ###EcTTcEEcEEcTTccccEEEcTTcEEEEEEccTTGGGcHHHcTcTTcTTTTcccEEEEEEEETTccTTcEEEEEEEEEEEcccccGGcTTGGGcccccccccEEEEEEEETTcEEcTTccEEcccccTTccccTTcEcccccccEEcccccTTEEccccTTcEEEEcccTTEEEEEEEEEEEccTccTccTTcTTTTccccEEEcccEEEEEEEHHTGGGHHHHGGGcccHHHHHHHHHHHHHHHHHcHccccHHHHHHHHHHHcEEEEEEccccccEEEEEEEGGGcccTT### DISOP:02AL 298-299| PSIPRED cEEEEcccEEEEEccccccEEEEccccEEEEEEEccccccccccccccccccccccccccccEEEcccccccEEEEEEEEEEEcccEEEEEEccccccHHHccccEEEEEEEEccEEEEcccEEEcccccccEEEcccHHHcccccccccccccccccccccccEEEEEEEEcccEEEEccHHHHccccEEEEEEEEccEEEEEEEEEEEcccccccEEEccccEEEEEEcccHHHHHHHHHHHHHHHHHHHccccHHHHHHHEEEEEEEEEEEEEcccEEEEEEEEHHHHHHccccc //