[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV56942.1
DDBJ      :             TraX family protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:237 amino acids
:PSIPRED
:RPS:PFM   4->219 PF05857 * TraX 1e-15 35.0 %
:HMM:PFM   5->226 PF05857 * TraX 7.3e-43 37.4 203/219  
:BLT:SWISS 5->152 FIMCH_DICNO 2e-09 34.0 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV56942.1 GT:GENE ACV56942.1 GT:PRODUCT TraX family protein GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION 3481919..3482632 GB:FROM 3481919 GB:TO 3482632 GB:DIRECTION + GB:PRODUCT TraX family protein GB:NOTE PFAM: TraX family protein; KEGG: pag:PLES_45101 TraX family protein GB:PROTEIN_ID ACV56942.1 GB:DB_XREF GI:257476622 InterPro:IPR008875 LENGTH 237 SQ:AASEQ MRGVSSFTLKVVAIVGMTFNHACYIFYPYLPAEALLLLFGFGGLTFPIMAFLLVEGYHHTSNIKRYAGRLLAFALVSQVPYGLFLAHNLNVLFTLLIGLGILYLYDTMESRGGFWLAAAALVTASALCDWGIIGPLMILMMRAIPDRRQRIVLPLLVPILGNGLPALSDYMAAFDPALLPFALYPLLGCTATIPLLLAYNGSRGRPMKWLFYAYYPAHILVLGLAKGLLLGDWGLGL GT:EXON 1|1-237:0| BL:SWS:NREP 1 BL:SWS:REP 5->152|FIMCH_DICNO|2e-09|34.0|147/244| TM:NTM 6 TM:REGION 30->52| TM:REGION 76->98| TM:REGION 117->139| TM:REGION 150->172| TM:REGION 178->200| TM:REGION 215->237| SEG 35->46|llllfgfggltf| SEG 95->105|lliglgilyly| SEG 116->127|laaaalvtasal| SEG 172->187|aafdpallpfalypll| SEG 220->236|lvlglakglllgdwglg| RP:PFM:NREP 1 RP:PFM:REP 4->219|PF05857|1e-15|35.0|200/220|TraX| HM:PFM:NREP 1 HM:PFM:REP 5->226|PF05857|7.3e-43|37.4|203/219|TraX| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PSIPRED ccccHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccc //