[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV56951.1
DDBJ      :             UspA domain protein
Swiss-Prot:             

Homologs  Archaea  25/68 : Bacteria  20/915 : Eukaryota  3/199 : Viruses  0/175   --->[See Alignment]
c.26.2
:161 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   1->156 1mjhA PDBj 5e-09 29.7 %
:RPS:PDB   2->158 2dumA PDBj 4e-19 26.4 %
:RPS:SCOP  1->157 1mjhA  c.26.2.4 * 2e-24 28.8 %
:HMM:SCOP  3->156 2gm3A1 c.26.2.4 * 3e-25 35.9 %
:RPS:PFM   6->156 PF00582 * Usp 2e-10 38.8 %
:HMM:PFM   3->156 PF00582 * Usp 5.8e-29 33.3 138/140  
:BLT:SWISS 2->161 Y531_METJA 2e-12 37.9 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV56951.1 GT:GENE ACV56951.1 GT:PRODUCT UspA domain protein GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION 3493474..3493959 GB:FROM 3493474 GB:TO 3493959 GB:DIRECTION + GB:PRODUCT UspA domain protein GB:NOTE PFAM: UspA domain protein; KEGG: rme:Rmet_4395 UspA GB:PROTEIN_ID ACV56951.1 GB:DB_XREF GI:257476631 InterPro:IPR006015 InterPro:IPR006016 LENGTH 161 SQ:AASEQ MLYDNIMIPYDGSASSKAALAEAVRFAKDDPGLTLRIVQIIDTDQLAIDKLEAEGRDEQTVASSAMLQKTYEEVTEEASKALHREIDPLLSGLMNKVYIELLQETQPGGQIVTYAIDNLCDLIVMGSRGLGALRGILGSVSSYVLRNADVPVLIVKEGTNE GT:EXON 1|1-161:0| BL:SWS:NREP 1 BL:SWS:REP 2->161|Y531_METJA|2e-12|37.9|145/170| BL:PDB:NREP 1 BL:PDB:REP 1->156|1mjhA|5e-09|29.7|138/143| RP:PDB:NREP 1 RP:PDB:REP 2->158|2dumA|4e-19|26.4|140/143| RP:PFM:NREP 1 RP:PFM:REP 6->156|PF00582|2e-10|38.8|134/139|Usp| HM:PFM:NREP 1 HM:PFM:REP 3->156|PF00582|5.8e-29|33.3|138/140|Usp| GO:PFM:NREP 1 GO:PFM GO:0006950|"GO:response to stress"|PF00582|IPR006016| RP:SCP:NREP 1 RP:SCP:REP 1->157|1mjhA|2e-24|28.8|139/143|c.26.2.4| HM:SCP:REP 3->156|2gm3A1|3e-25|35.9|145/0|c.26.2.4|1/1|Adenine nucleotide alpha hydrolases-like| OP:NHOMO 62 OP:NHOMOORG 48 OP:PATTERN -----1112112211---111---1112--41----1------1-----1111--------------- --------------------------------------------------------------------------------33-------------------------------------------------------------------------------------------------------------------------------------------1----------1---------------------------2-----------111---------------------------------------------------------------------------------11------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------1-------1--------------------11-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11111------------------------------------------------------------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------122------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 158 STR:RPRED 98.1 SQ:SECSTR ccccEEEEEccccHHHHHHHHHHHHHcccccccEEEEEEEEETTGGGHHHTccTHHHHHHHHcccccTTcHHHHHHHHHHHHHHHHHHHHHHTTccEEEEEEEEEcHHHHHHHHHHHTTccEEEEEcccccccTTcccHHHHHHHHHccccEEEEccc### PSIPRED ccccEEEEEccccHHHHHHHHHHHHHHHHccccEEEEEEEEccHHHcccccccccccHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccEEEEEEcccHHHHHHHHHHHccccEEEEEcccccHHHHHHHHHHHHHHHHccccEEEEcccccc //