[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV56959.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  95/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.100.1c.2.1
:297 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   5->274 2i76A PDBj 7e-16 29.7 %
:RPS:PDB   1->246 2ahrE PDBj 6e-10 14.3 %
:RPS:SCOP  1->158 2f1kA2  c.2.1.6 * 2e-13 17.9 %
:RPS:SCOP  165->273 2i76A1  a.100.1.10 * 2e-16 27.3 %
:HMM:SCOP  1->161 2amfA2 c.2.1.6 * 7.9e-20 23.7 %
:RPS:PFM   1->115 PF10727 * Rossmann-like 7e-08 28.7 %
:RPS:PFM   134->244 PF10728 * DUF2520 1e-15 35.1 %
:HMM:PFM   132->246 PF10728 * DUF2520 7.7e-37 36.5 115/132  
:HMM:PFM   3->84 PF03807 * F420_oxidored 2e-09 29.6 81/96  
:HMM:PFM   99->155 PF08861 * DUF1828 0.00068 17.5 57/90  
:BLT:SWISS 5->180 TYRA_STAS1 2e-06 29.1 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV56959.1 GT:GENE ACV56959.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION complement(3501316..3502209) GB:FROM 3501316 GB:TO 3502209 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:NOTE KEGG: sat:SYN_02774 putative cytoplasmic protein GB:PROTEIN_ID ACV56959.1 GB:DB_XREF GI:257476639 LENGTH 297 SQ:AASEQ MRAGFIGAGKVGFSLGKYLKENGVEITGYFSKSPESAKSAADFTNTKLYKSIENILSDSDTLFITVPDGQISKVWDYMKNLDIKNKNICHCSGSISSTVFFDGENLGANIYSVHPLYAISDKCESWKHLNKAYFTVEGSAENLDEIKSIFERAGNKVIAMGAENKSLYHCGAVVVSNLVNGLFQVGAEMLVKCGFDKKDAKKALVPLFTGNADTLAEKGVAAALTGPVERNDLSTITKHIEAIKAAWINESEEKVGYEMIYLLLSEKLLSIAQEKHLDSDYLKMTEVIKNEKHSIHF GT:EXON 1|1-297:0| BL:SWS:NREP 1 BL:SWS:REP 5->180|TYRA_STAS1|2e-06|29.1|172/363| BL:PDB:NREP 1 BL:PDB:REP 5->274|2i76A|7e-16|29.7|232/244| RP:PDB:NREP 1 RP:PDB:REP 1->246|2ahrE|6e-10|14.3|231/252| RP:PFM:NREP 2 RP:PFM:REP 1->115|PF10727|7e-08|28.7|115/120|Rossmann-like| RP:PFM:REP 134->244|PF10728|1e-15|35.1|111/132|DUF2520| HM:PFM:NREP 3 HM:PFM:REP 132->246|PF10728|7.7e-37|36.5|115/132|DUF2520| HM:PFM:REP 3->84|PF03807|2e-09|29.6|81/96|F420_oxidored| HM:PFM:REP 99->155|PF08861|0.00068|17.5|57/90|DUF1828| RP:SCP:NREP 2 RP:SCP:REP 1->158|2f1kA2|2e-13|17.9|156/165|c.2.1.6| RP:SCP:REP 165->273|2i76A1|2e-16|27.3|99/103|a.100.1.10| HM:SCP:REP 1->161|2amfA2|7.9e-20|23.7|152/0|c.2.1.6|1/1|NAD(P)-binding Rossmann-fold domains| OP:NHOMO 96 OP:NHOMOORG 95 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------11----------------1---------1-------111--1-------111-1---1-----------------------------111111----------------------------------------------1-------------------------------------------------------------1---------------------------------------------------------------------1---1---------111111-----1----1-1111211--1111-1------1---------------------------------------------------------------------------------------------------------------------------------1111-11111111-1-11111-1------11---------1--11-----11--------------111-----------1-1----1-------1--------------------------------------------------------------------------------------------------------------------------------------------------------------111111111-------------------------------------------------------------------------------------------------------------------------------------11-1111111--- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 289 STR:RPRED 97.3 SQ:SECSTR cEEEEEcccHHHHHHHHHTTcccEEEEEEEcccHHHHHHHHHHHTccccccHHHHHTTccEEEEcccGGGHHHHHTTcccTcccEEEccTccHHHHHHHHcTTccEEEEccGGGGTcEEEEEEEcTTEEEETTTEEEccHHHHHHHHHHHHTcEEEEEccGGGHHHHHHHTTTHHHHHHHHEHHHHHHHHHHTTccHHHHHHHHHHHHHHHHHHHHHccccHHHccTTcHHHHHHHHHTHHHHHHHHHHHcTTccTcccHHHHHHHHHHHHHHHTcTTccGGGGHHHHH######## DISOP:02AL 297-298| PSIPRED cEEEEEcccHHHHHHHHHHHHcccEEEEEEcccHHHHHHHHHHcccEEEccHHHHHccccEEEEEccHHHHHHHHHHHHHccccccEEEEccccccHHHHHHHHHcccEEEEEcccccccccHHHHHHccccEEEEEccHHHHHHHHHHHHHHcccEEEEcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHccccHHccccccccccHHHHHHHHHHHHcccccHHHcHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHcccccccc //