[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV56960.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  15/68 : Bacteria  27/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.25.1
:123 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   27->78 1zpyG PDBj 3e-06 45.1 %
:RPS:PDB   18->77 2cf7A PDBj 4e-05 10.0 %
:RPS:SCOP  18->78 1zpyA1  a.25.1.5 * 9e-09 39.3 %
:HMM:SCOP  6->88 1zpyA1 a.25.1.5 * 4.4e-18 36.1 %
:HMM:PFM   21->74 PF03232 * COQ7 3.4e-07 27.8 54/172  
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV56960.1 GT:GENE ACV56960.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION 3502428..3502799 GB:FROM 3502428 GB:TO 3502799 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:NOTE KEGG: pca:Pcar_2998 hypothetical protein GB:PROTEIN_ID ACV56960.1 GB:DB_XREF GI:257476640 LENGTH 123 SQ:AASEQ MPSFPNPFAGNVDRKMTNTELMQALRIDIAGELEAIFLYDAHYQATDDPAAKAVLADIRDEEKAHMGELITLMRHLDPTETEFFLEGEGEVQEKLAELGIKTDGEIAPAPAEPAPAPTVGDLS GT:EXON 1|1-123:0| SEG 79->90|tetefflegege| SEG 107->117|apapaepapap| BL:PDB:NREP 1 BL:PDB:REP 27->78|1zpyG|3e-06|45.1|51/90| RP:PDB:NREP 1 RP:PDB:REP 18->77|2cf7A|4e-05|10.0|60/156| HM:PFM:NREP 1 HM:PFM:REP 21->74|PF03232|3.4e-07|27.8|54/172|COQ7| RP:SCP:NREP 1 RP:SCP:REP 18->78|1zpyA1|9e-09|39.3|61/91|a.25.1.5| HM:SCP:REP 6->88|1zpyA1|4.4e-18|36.1|83/0|a.25.1.5|1/1|Ferritin-like| OP:NHOMO 44 OP:NHOMOORG 42 OP:PATTERN --1-------------1--11-----------------1111-1111-1------1--------1--- --------------------------------------------------------------------------------1------------------------------------------------------------111--------------------------------------------11-------------------------------------------------------------------------------------------------------------------------------------1------------------------1---------1--1----11--1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------1----------------1111----1--1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------1--11-1-----2 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 66 STR:RPRED 53.7 SQ:SECSTR ############GGccccccHHHHHHHHHHHHHHHHHHHHHHHHHcccTTHHHHHHHHHHHHHHHHHHHHHHHHHTTH############################################# PSIPRED cccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccc //