[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV56964.1
DDBJ      :             fumarate reductase/succinate dehydrogenase flavoprotein domain protein
Swiss-Prot:             

Homologs  Archaea  1/68 : Bacteria  134/915 : Eukaryota  4/199 : Viruses  0/175   --->[See Alignment]
b.52.1c.3.1
:552 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   83->548 1qo8A PDBj 7e-20 26.6 %
:RPS:PDB   42->550 1d4cB PDBj 4e-26 23.6 %
:RPS:SCOP  61->344 1d4cA2  c.3.1.4 * 2e-11 15.8 %
:RPS:SCOP  333->548 2pnwA1  b.52.1.4 * 9e-12 14.6 %
:HMM:SCOP  54->548 1jnrA2 c.3.1.4 * 1.1e-37 25.9 %
:RPS:PFM   84->344,435->513 PF00890 * FAD_binding_2 6e-09 34.2 %
:HMM:PFM   64->520 PF00890 * FAD_binding_2 2.6e-51 29.2 380/421  
:BLT:SWISS 83->548 FRD2_SHEFN 2e-19 26.6 %
:PROS 481->490|PS00178|AA_TRNA_LIGASE_I
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV56964.1 GT:GENE ACV56964.1 GT:PRODUCT fumarate reductase/succinate dehydrogenase flavoprotein domain protein GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION complement(3507113..3508771) GB:FROM 3507113 GB:TO 3508771 GB:DIRECTION - GB:PRODUCT fumarate reductase/succinate dehydrogenase flavoprotein domain protein GB:NOTE PFAM: fumarate reductase/succinate dehydrogenase flavoprotein domain protein; FAD dependent oxidoreductase; KEGG: glo:Glov_0945 succinate dehydrogenase GB:PROTEIN_ID ACV56964.1 GB:DB_XREF GI:257476644 InterPro:IPR001412 InterPro:IPR003953 InterPro:IPR006076 InterPro:IPR006311 LENGTH 552 SQ:AASEQ MATLKNGLSRRSFLTLGGVAALGGAAALAGCAPQASSSANADAKGATDDAASAMQTADQTKECDIAIVGAGGAGMWAAVEAVRAGKSVVVIEKGGNVGVANGSLAGGPFMVGSKLQQEAGVEFTVEEAFNHIMEYAHWSTNAAAVKAAVAISGETVDQFTDDFGVPTGLRPDNYGAGHASVRANFQSDPKDSKTQAKGEDRMKPLQEFVESKGGEFLFNTAGKRLIMEDGACTGVQCEGDGVTDVKAKAVIVATGGFLGNVDMMREKFGTFVNPLGNVLSVGEGIDMVQAAGGQLSTQWGIAGNEFTGSNQKADGLYDRKSAAFTIGIYGTLLVNNQGRRFSNEGKFANLPLALGGAISLVGGKYYAVVDQAYVDGLNSGKDAWTLCGADEVNWRTGMMTLKDKPLENVQGSIDDAVSAGWAFKADTIEALAQAIDAPELVETLDEYNGYCADGNDEQFYKPACFLQPVTTGPFYAFQYEPSAWVTIGGIRTNDRLQAIDGEGVAIPGLYVAGADNGTLMSAPYCDYEGYSLMCAYCGGRLAGQYAVETIDA GT:EXON 1|1-552:0| BL:SWS:NREP 1 BL:SWS:REP 83->548|FRD2_SHEFN|2e-19|26.6|413/588| PROS 481->490|PS00178|AA_TRNA_LIGASE_I|PDOC00161| SEG 16->32|lggvaalggaaalagca| SEG 66->82|aivgaggagmwaaveav| SEG 142->150|aaavkaava| BL:PDB:NREP 1 BL:PDB:REP 83->548|1qo8A|7e-20|26.6|413/564| RP:PDB:NREP 1 RP:PDB:REP 42->550|1d4cB|4e-26|23.6|453/566| RP:PFM:NREP 1 RP:PFM:REP 84->344,435->513|PF00890|6e-09|34.2|299/375|FAD_binding_2| HM:PFM:NREP 1 HM:PFM:REP 64->520|PF00890|2.6e-51|29.2|380/421|FAD_binding_2| GO:PFM:NREP 2 GO:PFM GO:0009055|"GO:electron carrier activity"|PF00890|IPR003953| GO:PFM GO:0016491|"GO:oxidoreductase activity"|PF00890|IPR003953| RP:SCP:NREP 2 RP:SCP:REP 61->344|1d4cA2|2e-11|15.8|273/322|c.3.1.4| RP:SCP:REP 333->548|2pnwA1|9e-12|14.6|192/354|b.52.1.4| HM:SCP:REP 54->548|1jnrA2|1.1e-37|25.9|282/357|c.3.1.4|1/1|FAD/NAD(P)-binding domain| OP:NHOMO 329 OP:NHOMOORG 139 OP:PATTERN ------------------------------1------------------------------------- --------223---321----2--12-----121111213-1-3----1-----2-----113----1-----------8oC-----------------------------------------------------------------------------------------------------1-----------------------------------------111111------------------11--12-211111-122---1-----------------22---------------------------------2-A5-2------------------13-2------KH-----1-----------------------2-1-------------------------2--2---1------------1-1----------------------------------------------------------41--2442-----1-1-------2------1----11-----1-----2---------------------------1--------------1-41-1--21-2-----21------------------1-------1------1-11221-2321131231331---------------21-1------------------------------111121------------------------------------------------------------------------------------2-11-1-11--3232-----------------------1----------------------------------------------------------------------------- ----------------------------------------------------11-------------------------------------1--------------------------------------------------------------------------------1-------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 510 STR:RPRED 92.4 SQ:SECSTR #####################################cccTTccHHHHHHHHH###ccccEEccEEEEcccHHHHHHHHHHHHHTccEEEEcccccccTTGGGccccEEccccHHHHHTTccccHHHHHHHHHHHTTTcccHHHHHHHHHHHHHHHHHHHHHTTccccccEEEccTTcccccEEEcccHHHHHcccHHHHHHHHHHHHHHHTTcEEEccEEEEEEEEccccEEEEEEETTEEEEEEccEEEEcccccTTcHHHHHHHcGTTcEEcccTTcccHHHHHHHTTTccEEcTTcEEEEEEEEEEcTTTcccTcccccTHHHHTTcEEEcccccccccTTccccHHHHHHHHHTcGGGcEEEEEEHHHHHHcTHHHHHHHHHHHHHTcTTccEEEEEEHHHHHHcTHHHHHHHTTccEEEccHHHHHHHHcHHHHHHHHHHHHHHHHHTcccccccccccccccccccEEEEEEEEEEEEEccEEEccTTcEEETTTccEEEEEEEccTTEEcccTTcccccTTHHHHHHHHHHHHHHHHHHHHH## DISOP:02AL 552-553| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccEEEEccHHHHHHHHHHHHcccccEEEEEccccccccHHHccccccccccHHHHHHcccccHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHcccEEEEccEEEEEEEEccEEEEEEEEcccEEEEEEEEEEEccccccccHHHHHHHHHHHcccccccccHHHHHHHHHHHccEEEcccccccccccccccccccccccccEEEEcccccEEEEcccccccccccccccccHHcccccccccccHHHHHHHHHHHHHHccccccEEEccHHHcccccccccccccHHHHHHHHHHHHHcccEEEcccHHHHHHHccHHHHHHHHHHHHHHHHcccccccccccccccccccccEEEEEEEEEEEEEcccEEEccccEEEcccccccccEEEcHHHccccccccccccccHHHHHHHHHHHHHHHHHHHHHcc //