[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV56968.1
DDBJ      :             ErfK/YbiS/YcfS/YnhG family protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  58/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
b.160.1d.335.1
:492 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   263->489 1zatA PDBj 2e-29 33.3 %
:RPS:SCOP  261->337 1zatA2  d.335.1.1 * 4e-08 18.4 %
:RPS:SCOP  364->489 1zatA1  b.160.1.1 * 2e-16 44.2 %
:HMM:SCOP  232->355 1zatA2 d.335.1.1 * 7.3e-17 26.2 %
:HMM:SCOP  360->491 1zatA1 b.160.1.1 * 1.4e-26 28.9 %
:RPS:PFM   239->337 PF12229 * PG_binding_4 2e-05 29.5 %
:RPS:PFM   363->489 PF03734 * YkuD 4e-05 29.3 %
:HMM:PFM   100->211 PF12229 * PG_binding_4 3.6e-11 22.6 106/114  
:HMM:PFM   227->338 PF12229 * PG_binding_4 5.8e-15 29.0 107/114  
:HMM:PFM   364->489 PF03734 * YkuD 6.6e-17 28.8 111/116  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV56968.1 GT:GENE ACV56968.1 GT:PRODUCT ErfK/YbiS/YcfS/YnhG family protein GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION 3512239..3513717 GB:FROM 3512239 GB:TO 3513717 GB:DIRECTION + GB:PRODUCT ErfK/YbiS/YcfS/YnhG family protein GB:NOTE PFAM: ErfK/YbiS/YcfS/YnhG family protein; KEGG: bca:BCE_3256 hypothetical protein GB:PROTEIN_ID ACV56968.1 GB:DB_XREF GI:257476648 InterPro:IPR005490 LENGTH 492 SQ:AASEQ MKHAAPADQTPAPASSPETTARRRFSAPKIIGIVAGSIVGLLLIAYVAGSLYFTDRFMPNTVLGDHDVSLKTSSEVQAILDDALSDYTVAVSGQGFSMKLSAKDAGVSFDGQAIVADALGNTNPWLWPLEITREHDETDSLAASSGSSLANAVRTAVDEFNATATPPTDAVVAFDEQKNAFAVQPEATGTALDADAVAKAIGSAIASMQPTAKLTADALQQPAVPATDPKLQAAAEAANQLVKADMQLMMGGDVAAEVNPALVSTWISFDESLTPSLDEEALVAWAKQLEVACDTVGTERTYTRPDGKVITVAGGPYGWLTDGEALLELVKEGVANGTVGAVDIPCKTTGTAYNGAGAQDWSARYCDIDLSEQHVRFYDETGTLIWEAPCVSGTPNGAHNTPTGVFWLNQKASPSVLKGTNLDGSKYESAVRYWMPFVGNVIGLHDADWQAAFGGTLYQQGRGSHGCVNLPVGSAADLFGIIQSGDVVVCHW GT:EXON 1|1-492:0| TM:NTM 1 TM:REGION 29->51| SEG 140->152|slaassgsslana| SEG 162->173|atatpptdavva| BL:PDB:NREP 1 BL:PDB:REP 263->489|1zatA|2e-29|33.3|216/248| RP:PFM:NREP 2 RP:PFM:REP 239->337|PF12229|2e-05|29.5|95/114|PG_binding_4| RP:PFM:REP 363->489|PF03734|4e-05|29.3|123/136|YkuD| HM:PFM:NREP 3 HM:PFM:REP 100->211|PF12229|3.6e-11|22.6|106/114|PG_binding_4| HM:PFM:REP 227->338|PF12229|5.8e-15|29.0|107/114|PG_binding_4| HM:PFM:REP 364->489|PF03734|6.6e-17|28.8|111/116|YkuD| RP:SCP:NREP 2 RP:SCP:REP 261->337|1zatA2|4e-08|18.4|76/122|d.335.1.1| RP:SCP:REP 364->489|1zatA1|2e-16|44.2|120/126|b.160.1.1| HM:SCP:REP 232->355|1zatA2|7.3e-17|26.2|122/0|d.335.1.1|1/1|L,D-transpeptidase pre-catalytic domain-like| HM:SCP:REP 360->491|1zatA1|1.4e-26|28.9|128/0|b.160.1.1|1/1|L,D-transpeptidase catalytic domain-like| OP:NHOMO 70 OP:NHOMOORG 58 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------1------1131----------------------------------------------------------------------------------------------------------------11111111-111111------111-----------------------------------121111111111111111-2-----------------------------------------------------1411-1111313-111-------11--2--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 259 STR:RPRED 52.6 SQ:SECSTR ##########################################################################################################################################################################################################################cccccccccccEHHHHHHHTHHHHHTTccEEcccTT###ccEEEHHHHEEEETTEEcEEcHHHHHHHHHHHHHHHcTTTccEEEEcccccEEEEccccccEEEcHHHHHHHHHHHHHHTcccEEEcccEEEccccccccccc###cEEEEETTTTEEEEEET#TEEEEEEEcccccTTcc##cccEEEEccccEEEEEccccc##ccccccEEEEEEEccccccEEEEcTTcccccTTHHHH#HcccccEEEcHHHHHHHHHHccTTcEEE### PSIPRED ccccccccccccccccccccHHcccccHHHHHHHHHHHHHHHHHHHccccEEEEEEEcccEEEccEEcccccHHHHHHHHHHHccccEEEEEccccEEEEEHHHcccccccHHHHHHHHcccccEEEEEccccccccccccccccHHHHHHHHHHHHHHHcccccccccEEEEEEccccEEEEEEccccccccHHHHHHHHHHHHHccccEEEEEEcccEEccccccHHHHHHHHHHHHHHccccEEEEccccEEEEEcHHHcccEEEEcccccccccHHHHHHHHHHcccccccccccEEEEcccccEEEEcccEEEEEEcccHHHHHHHHHHHccccccccccEEEccccccccccccccccEEEEEccccEEEEEEcccEEEEEEEEEEEEcccccccccEEEEEEEEccccEEEEccccccccccccccEEEEEccEEEEEccccccccccccccccccccccccccHHHHHHHHHHcccccEEEEEc //