[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV56982.1
DDBJ      :             FHA domain containing protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  62/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
b.26.1
:414 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   344->411 2kklA PDBj 2e-09 41.8 %
:RPS:PDB   327->409 2cswA PDBj 3e-15 24.1 %
:RPS:SCOP  327->409 2pieA1  b.26.1.2 * 2e-15 24.1 %
:HMM:SCOP  278->412 1g3gA_ b.26.1.2 * 5.6e-27 31.3 %
:RPS:PFM   4->114 PF12401 * DUF3662 9e-15 40.5 %
:RPS:PFM   341->405 PF00498 * FHA 7e-12 50.8 %
:HMM:PFM   4->116 PF12401 * DUF3662 2.8e-34 39.8 113/116  
:HMM:PFM   342->405 PF00498 * FHA 8.1e-22 42.2 64/68  
:HMM:PFM   256->284 PF00137 * ATP-synt_C 0.001 37.9 29/66  
:BLT:SWISS 337->411 ODHI_COREF 2e-09 44.6 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV56982.1 GT:GENE ACV56982.1 GT:PRODUCT FHA domain containing protein GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION 3532022..3533266 GB:FROM 3532022 GB:TO 3533266 GB:DIRECTION + GB:PRODUCT FHA domain containing protein GB:NOTE PFAM: Forkhead-associated protein; SMART: Forkhead-associated protein; KEGG: ank:AnaeK_2044 FHA domain containing protein GB:PROTEIN_ID ACV56982.1 GB:DB_XREF GI:257476662 InterPro:IPR000253 LENGTH 414 SQ:AASEQ MGFLSRFEGRMEDTFEGAADKMFDAPISPVQIAKKAEKQMRREKMVGAGKQYAPTLYTVLVNPDDDRRLMGYYPTLAGETETYLTAKASEQGLVMDGQPLVRFIVDEDLKHGKFDIIAEAVAAPIIAQLRAEEMHRYGLAAAPAPGGYGAPAQPYPAPRPQAPAPQQYGGYNQGYAAPAPAPAPYGGYDQHDPQGQYDPAPMNVDAYGQPQQLPYVPEDEIDRSIDYGEYTFDSRDFDEQRDSIQPLDRPEAVDPFAIGAAAAGAGVAAGAVAGAGMGAATSQPYPAPQPQPQAQPRMAAETVVFAGGQQAATPMPAQAAVRARLIDTTNNRAYDLASARLLIGRESKNDIAVHDVNASRTHAELRFEPQGVWTITDLGSTNGTLVNGREVATQPLSEGDRITIGMTNFMFTQA GT:EXON 1|1-414:0| BL:SWS:NREP 1 BL:SWS:REP 337->411|ODHI_COREF|2e-09|44.6|74/142| SEG 116->127|iiaeavaapiia| SEG 140->188|aaapapggygapaqpypaprpqapapqqyggynqgyaapapapapyggy| SEG 257->300|aigaaaagagvaagavagagmgaatsqpypapqpqpqaqprmaa| SEG 306->320|aggqqaatpmpaqaa| BL:PDB:NREP 1 BL:PDB:REP 344->411|2kklA|2e-09|41.8|67/140| RP:PDB:NREP 1 RP:PDB:REP 327->409|2cswA|3e-15|24.1|83/145| RP:PFM:NREP 2 RP:PFM:REP 4->114|PF12401|9e-15|40.5|111/116|DUF3662| RP:PFM:REP 341->405|PF00498|7e-12|50.8|65/68|FHA| HM:PFM:NREP 3 HM:PFM:REP 4->116|PF12401|2.8e-34|39.8|113/116|DUF3662| HM:PFM:REP 342->405|PF00498|8.1e-22|42.2|64/68|FHA| HM:PFM:REP 256->284|PF00137|0.001|37.9|29/66|ATP-synt_C| RP:SCP:NREP 1 RP:SCP:REP 327->409|2pieA1|2e-15|24.1|83/127|b.26.1.2| HM:SCP:REP 278->412|1g3gA_|5.6e-27|31.3|134/164|b.26.1.2|1/1|SMAD/FHA domain| OP:NHOMO 79 OP:NHOMOORG 62 OP:PATTERN -------------------------------------------------------------------- ----1----------22----1--1-------1---1-11111311-11---111--1--11--1112321-11111111112-----------------------------------------------------22221---11------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11-11--------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------------------111151-1------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 91 STR:RPRED 22.0 SQ:SECSTR ##################################################################################################################################################################################################################################################################################################################################cEEETcccccEEccTTccEEEEccTTccEEcccccccTTcEEEEEcTTccEEEEcccccccEEEcccccccEEccccccEEEccccTEEEE# DISOP:02AL 414-415| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHccEEcccEEEcccEEEEEEcccHHHHHHccccHHHHHHHHHHHHHHHHcccEEccccEEEEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEEccccccEEEEEcccEEEEcccccccEEEcccccccccEEEEEccccEEEEEEccccccEEEccEEccEEEcccccEEEEccEEEEEEEc //