[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV56991.1
DDBJ      :             membrane protein-like protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  9/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:236 amino acids
:PSIPRED
:HMM:PFM   63->174 PF01794 * Ferric_reduct 3.5e-09 20.2 109/125  
:BLT:SWISS 57->221 Y572_TREPA 3e-16 45.1 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV56991.1 GT:GENE ACV56991.1 GT:PRODUCT membrane protein-like protein GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION complement(3544901..3545611) GB:FROM 3544901 GB:TO 3545611 GB:DIRECTION - GB:PRODUCT membrane protein-like protein GB:NOTE KEGG: dol:Dole_1440 glycosyl transferase family protein GB:PROTEIN_ID ACV56991.1 GB:DB_XREF GI:257476671 LENGTH 236 SQ:AASEQ MTLILVLAGAVAFAFACKRPIKSCPLAFYALAATLDVLFVVGSFAGLPPMLYDALFLLLHKCTLATALFAVVMYIGVFARDSRVATYLRPIRAELSIMAWLLSLGHMAIYLSSYAANLSTGLPQTNVAVALALALALFALLVVLGVTSFNVVKKRMKKETWKRVQLLAYPFWGLVYVHLLLMLVPSALRGGAPAQMAVVVYSVVFVGYAVLRIRRAAIDRRKEESGRVGDAVQNPA GT:EXON 1|1-236:0| BL:SWS:NREP 1 BL:SWS:REP 57->221|Y572_TREPA|3e-16|45.1|164/100| TM:NTM 7 TM:REGION 1->17| TM:REGION 28->50| TM:REGION 57->79| TM:REGION 92->114| TM:REGION 128->150| TM:REGION 164->186| TM:REGION 191->212| SEG 5->16|lvlagavafafa| SEG 127->144|vavalalalalfallvvl| SEG 197->210|avvvysvvfvgyav| HM:PFM:NREP 1 HM:PFM:REP 63->174|PF01794|3.5e-09|20.2|109/125|Ferric_reduct| OP:NHOMO 15 OP:NHOMOORG 9 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------35-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------111-1--1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PSIPRED cHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHcccccccHHEHHHHccHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccc //