[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV57060.1
DDBJ      :             protein of unknown function DUF559
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  90/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.52.1
:133 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   46->116 3hrlA PDBj 1e-05 42.1 %
:RPS:SCOP  10->117 1cw0A  c.52.1.15 * 8e-09 22.4 %
:HMM:SCOP  1->116 1cw0A_ c.52.1.15 * 1.2e-08 24.3 %
:RPS:PFM   39->112 PF04480 * DUF559 8e-10 44.6 %
:HMM:PFM   10->113 PF04480 * DUF559 1.6e-27 43.1 102/109  
:BLT:SWISS 5->114 Y1162_HAEIN 1e-16 41.7 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV57060.1 GT:GENE ACV57060.1 GT:PRODUCT protein of unknown function DUF559 GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION 3627831..3628232 GB:FROM 3627831 GB:TO 3628232 GB:DIRECTION + GB:PRODUCT protein of unknown function DUF559 GB:NOTE PFAM: protein of unknown function DUF559; KEGG: gsu:GSU1369 hypothetical protein GB:PROTEIN_ID ACV57060.1 GB:DB_XREF GI:257476740 InterPro:IPR007569 LENGTH 133 SQ:AASEQ MNTTRRQLLAQRAENMRNQMTYPERRLWFSFLREYPTPFVAQKVIGSYIIDSYCRKARLSIELDGDSHYTENQKEYDRVRTTFLEMLEIKELRFTNNEVMENLEGVCEAIHAEVLKRRNDVHGSLFQKMKDKH GT:EXON 1|1-133:0| BL:SWS:NREP 1 BL:SWS:REP 5->114|Y1162_HAEIN|1e-16|41.7|108/157| BL:PDB:NREP 1 BL:PDB:REP 46->116|3hrlA|1e-05|42.1|57/91| RP:PFM:NREP 1 RP:PFM:REP 39->112|PF04480|8e-10|44.6|74/92|DUF559| HM:PFM:NREP 1 HM:PFM:REP 10->113|PF04480|1.6e-27|43.1|102/109|DUF559| RP:SCP:NREP 1 RP:SCP:REP 10->117|1cw0A|8e-09|22.4|107/155|c.52.1.15| HM:SCP:REP 1->116|1cw0A_|1.2e-08|24.3|115/155|c.52.1.15|1/1|Restriction endonuclease-like| OP:NHOMO 117 OP:NHOMOORG 90 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------1-------------------1--1----------------------2-------------------311-112----------2-----2---------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------2--1---------2-2121223----------------------1--11---1--11-1---1--------------------------------------------------------3--2------------------------------------------------1----------1111111-------1--1-----------122-1211--------------------------------------------------------------------1--1-------------1---1---11--111---1-1--111111--1----------------------111-1111-----------------------22--2----111--2-12113---------------------1--------------------1-----------------1-------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 57 STR:RPRED 42.9 SQ:SECSTR #############################################TTEEEE#EETTTTEEEEEEc#########cccHHHHHHHHHTTcEEEEEEHHHHHHcHHHHH####HHHHH################# DISOP:02AL 132-134| PSIPRED cccccccHHHHHHHHHHHcccHHHHHHHHHHHHHcccccccccccccEEEEEEccccEEEEEEEcHHcccHHHHHHHHHHHHHHHHcccEEEEEEHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc //