[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV57062.1
DDBJ      :             single-stranded nucleic acid binding R3H domain protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  190/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.68.7
:173 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   11->170 3gkuA PDBj 5e-19 36.4 %
:RPS:PDB   104->173 2cpmA PDBj 2e-06 18.8 %
:RPS:SCOP  136->173 1mszA  d.68.7.1 * 8e-07 24.3 %
:HMM:SCOP  113->174 1mszA_ d.68.7.1 * 2e-07 31.1 %
:HMM:PFM   119->172 PF01424 * R3H 2.3e-16 40.8 49/55  
:BLT:SWISS 28->173 JAG_BACHD 8e-20 36.4 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV57062.1 GT:GENE ACV57062.1 GT:PRODUCT single-stranded nucleic acid binding R3H domain protein GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION complement(3629429..3629950) GB:FROM 3629429 GB:TO 3629950 GB:DIRECTION - GB:PRODUCT single-stranded nucleic acid binding R3H domain protein GB:NOTE PFAM: single-stranded nucleic acid binding R3H domain protein; SMART: single-stranded nucleic acid binding R3H domain protein; KEGG: sfu:Sfum_2598 single-stranded nucleic acid binding R3H domain protein GB:PROTEIN_ID ACV57062.1 GB:DB_XREF GI:257476742 InterPro:IPR001374 LENGTH 173 SQ:AASEQ MAEELVDEKPLDEEPAELTDEDLDRIADTAIGALQDILKYFEVGEVTIDEYEGDEGELILDITGDDLAVLIGRHGKTLDALQFLVSAITVRTIGFRYPVIVDVEGYKSRQREKLESIARSSANRAASQNRSIKLRPMTPYERRIVHICLRDDDRVETASEGEGSARHVVILPR GT:EXON 1|1-173:0| BL:SWS:NREP 1 BL:SWS:REP 28->173|JAG_BACHD|8e-20|36.4|143/207| SEG 116->132|siarssanraasqnrsi| BL:PDB:NREP 1 BL:PDB:REP 11->170|3gkuA|5e-19|36.4|154/199| RP:PDB:NREP 1 RP:PDB:REP 104->173|2cpmA|2e-06|18.8|69/94| HM:PFM:NREP 1 HM:PFM:REP 119->172|PF01424|2.3e-16|40.8|49/55|R3H| RP:SCP:NREP 1 RP:SCP:REP 136->173|1mszA|8e-07|24.3|37/62|d.68.7.1| HM:SCP:REP 113->174|1mszA_|2e-07|31.1|61/0|d.68.7.1|1/1|R3H domain| OP:NHOMO 190 OP:NHOMOORG 190 OP:PATTERN -------------------------------------------------------------------- -1-11-------1-1-------1111-----11---11111111--1-----11111---1-1-11-1111111111111111-----------------------------------------------------1111111111-------------------------------------11111111111111111111111111111111111111-1--111111111-------------------1---11---------11-1---------------------------------------------------111111111111111-1111111111-11111111111111111111----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111111111111---------------111----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11111111111111111---------------------------11---1------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 163 STR:RPRED 94.2 SQ:SECSTR ##########cccccEEEEEEEcccHHHHHHHHHHHHTTTHHHTccEEEEEETTTTEEEEEEEcHHGHHccTTHHHHHHHHHHHHHHHHHHTcccccEEEEEcccccccHHHHHHHHHHHHHHHHcccccEEEcccccccHHHHHHHHHHHHHTcEEEEEcccccccEEEEEc DISOP:02AL 173-174| PSIPRED cccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHccccccEEEEEEccccEEEEEEEcHHHHHHHcccccHHHHHHHHHHHHHHHHHcccccEEEEEcHHHHHHHHHHHHHHHHHHHHHHHcccEEEcccccHHHHHHHHHHHHHccccEEEEEcccccEEEEEEEc //