[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV57063.1
DDBJ      :             60 kDa inner membrane insertion protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  839/915 : Eukaryota  20/199 : Viruses  0/175   --->[See Alignment]
a.59.1
:261 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   47->111 1e91A PDBj 2e-12 7.7 %
:RPS:SCOP  47->111 1e91A  a.59.1.1 * 9e-13 7.7 %
:RPS:PFM   23->218 PF02096 * 60KD_IMP 5e-24 42.6 %
:HMM:PFM   22->222 PF02096 * 60KD_IMP 2.8e-57 39.8 191/196  
:BLT:SWISS 2->226 OXAA_ACTSZ 5e-29 35.1 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV57063.1 GT:GENE ACV57063.1 GT:PRODUCT 60 kDa inner membrane insertion protein GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION complement(3629988..3630773) GB:FROM 3629988 GB:TO 3630773 GB:DIRECTION - GB:PRODUCT 60 kDa inner membrane insertion protein GB:NOTE PFAM: 60 kDa inner membrane insertion protein; KEGG: ilo:IL2637 preprotein translocase subunit YidC GB:PROTEIN_ID ACV57063.1 GB:DB_XREF GI:257476743 InterPro:IPR001708 LENGTH 261 SQ:AASEQ MWDVFKDWIFDIIHFFYDFCGDWGLAIIIVTVIFRILISPLMHKQTKSSFQMQKVQPLMQELQRKYADDQPRLQEEMQKLYAEVKFNPLAGCLPMLLQMPIFMALFQVLSEMGSRTSGTTYEFYNLVPSLVMRPSEALAVGFGTFVPYLILMVIFAGATFLPMVLMQMGNKDNPQRKQTMIMAAVMSVFMLWISWSSPAGVLLFWGASSLMGIAQQQISMRIMKKRDAEAAETIEVKPIEVDVTRKQKKPRPTKKDTTKRK GT:EXON 1|1-261:0| BL:SWS:NREP 1 BL:SWS:REP 2->226|OXAA_ACTSZ|5e-29|35.1|205/537| TM:NTM 4 TM:REGION 16->38| TM:REGION 88->110| TM:REGION 143->165| TM:REGION 185->207| SEG 27->38|iiivtvifrili| SEG 244->260|trkqkkprptkkdttkr| RP:PDB:NREP 1 RP:PDB:REP 47->111|1e91A|2e-12|7.7|65/85| RP:PFM:NREP 1 RP:PFM:REP 23->218|PF02096|5e-24|42.6|183/191|60KD_IMP| HM:PFM:NREP 1 HM:PFM:REP 22->222|PF02096|2.8e-57|39.8|191/196|60KD_IMP| GO:PFM:NREP 2 GO:PFM GO:0016021|"GO:integral to membrane"|PF02096|IPR001708| GO:PFM GO:0051205|"GO:protein insertion into membrane"|PF02096|IPR001708| RP:SCP:NREP 1 RP:SCP:REP 47->111|1e91A|9e-13|7.7|65/85|a.59.1.1| OP:NHOMO 954 OP:NHOMOORG 859 OP:PATTERN -------------------------------------------------------------------- -111111111111111112-11111111111111111211111111111--111-111111111112121111112111111211111111111--1--11111111-1-1111111111111111111111111111111--111111111-11--11111111-1--11111111111111111111111212222222222222222211222222221111222222121--------------1----111111111111111111111111112221111111111111111111111111111111121111222112111111111111111331111111-11-11111111-11111111111-11111111111111111111111111111111111-111111111111111111111111111111111111111111111111111111111111111111111111111111111-11111111111111111111111111111111111111111111111111111-1111111111111111111111111111111111111111111111111111111111111111111111111111111111--1111111111111111111111111111111-1111111111111111111111111111-111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11111-1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111--------------------------1111111111111 ------------------------------------------------------------------------------------------------------------4------------------------------------------------------------------1222N222222114-3122----3 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 65 STR:RPRED 24.9 SQ:SECSTR ##############################################cccHHHHHHHHHHHHHHHHTcccHHHHHHHHHHHHHHTTccccccccccccHHHHHHHHHHHTcc###################################################################################################################################################### DISOP:02AL 260-262| PSIPRED cccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHcccccccccccccccccccccccccccc //