[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV57064.1
DDBJ      :             protein of unknown function DUF37
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  646/915 : Eukaryota  22/199 : Viruses  0/175   --->[See Alignment]
:77 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   11->76 PF01809 * DUF37 8e-14 53.0 %
:HMM:PFM   11->76 PF01809 * DUF37 2.8e-30 48.5 66/68  
:BLT:SWISS 11->77 Y5278_BACLD 1e-19 55.2 %
:TM

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV57064.1 GT:GENE ACV57064.1 GT:PRODUCT protein of unknown function DUF37 GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION complement(3630820..3631053) GB:FROM 3630820 GB:TO 3631053 GB:DIRECTION - GB:PRODUCT protein of unknown function DUF37 GB:NOTE PFAM: protein of unknown function DUF37; KEGG: ngk:NGK_2660 UPF0161 protein GB:PROTEIN_ID ACV57064.1 GB:DB_XREF GI:257476744 InterPro:IPR002696 LENGTH 77 SQ:AASEQ MKAFLKQVPCKVAVFLVTFYRAAISPLFPSCCRFTPTCSEYGLIAFQRYGFCRGLKLTVKRVLRCRPGGSHGYDPVP GT:EXON 1|1-77:0| BL:SWS:NREP 1 BL:SWS:REP 11->77|Y5278_BACLD|1e-19|55.2|67/81| TM:NTM 1 TM:REGION 9->31| RP:PFM:NREP 1 RP:PFM:REP 11->76|PF01809|8e-14|53.0|66/68|DUF37| HM:PFM:NREP 1 HM:PFM:REP 11->76|PF01809|2.8e-30|48.5|66/68|DUF37| OP:NHOMO 688 OP:NHOMOORG 668 OP:PATTERN -------------------------------------------------------------------- 11111----1-1-1-1112-11--111111111111-11111--1111111-111-11---1111111111----1-11111111-11111111111--111111111111111111111111111111111111111111---1131111111111111-1111111111111111111111-11111111111111111111111111122111-111-11-1-1111111-111111111111-1111111-11111-111111-11111---1111111111111111111111111111111111111---1111111111111111111-1-111111111-111111111-1--1111-1111-1211--11-111111-11-1111111111111111111---------1-1-111111--1-11-1-1-1111111111----------1-11-1--------11--11111-111-111----11111-1111-111111111111111111111111111-11--11111111111-1111111111111111111111-111-1111-111----111111111111-1-------1--1---------------11111-1111111111111111111111-11-1-1-1-11-------11-1-1---11---1--11---1111-111111111----111--11--1---1-1-1-11-1---11-----111-1-11--11--1--111-1---11111-1-111111111111111111-1----1-1--1-1--111111111--11----1-1-1--1--1111-11-1-11111111111111--------1---------------------------111--11111111 ------------------------------------------------------------------------------------------------------------3-------------------------------------------------------------4---111116111111231-1111----1 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 77-78| PSIPRED cHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccc //