[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV57065.1
DDBJ      :             ribonuclease P protein component
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  3/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.14.1
:108 amino acids
:SECSTR
:PSIPRED
:RPS:PDB   2->107 1d6tA PDBj 3e-12 21.9 %
:RPS:SCOP  2->107 1a6fA  d.14.1.2 * 5e-12 21.9 %
:HMM:SCOP  2->107 1nz0A_ d.14.1.2 * 1.8e-20 30.8 %
:RPS:PFM   2->105 PF00825 * Ribonuclease_P 4e-10 33.0 %
:HMM:PFM   3->106 PF00825 * Ribonuclease_P 3.1e-23 23.1 104/111  
:BLT:SWISS 4->107 RNPA_STRMU 4e-09 30.4 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV57065.1 GT:GENE ACV57065.1 GT:PRODUCT ribonuclease P protein component GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION complement(3631065..3631391) GB:FROM 3631065 GB:TO 3631391 GB:DIRECTION - GB:PRODUCT ribonuclease P protein component GB:NOTE TIGRFAM: ribonuclease P protein component; PFAM: ribonuclease P protein; KEGG: nis:NIS_0879 ribonuclease P protein component GB:PROTEIN_ID ACV57065.1 GB:DB_XREF GI:257476745 InterPro:IPR000100 LENGTH 108 SQ:AASEQ METIKSRGDISDLFSCGKRLHTPYLTFIVLPTKQHGQQGRVAFIAGKKSGNAVWRNSAKRRMRAICHDLGGPWAGYDVIFLAKSGIMKSSYSKVHTACAETLKRAELR GT:EXON 1|1-108:0| BL:SWS:NREP 1 BL:SWS:REP 4->107|RNPA_STRMU|4e-09|30.4|102/119| RP:PDB:NREP 1 RP:PDB:REP 2->107|1d6tA|3e-12|21.9|105/117| RP:PFM:NREP 1 RP:PFM:REP 2->105|PF00825|4e-10|33.0|103/111|Ribonuclease_P| HM:PFM:NREP 1 HM:PFM:REP 3->106|PF00825|3.1e-23|23.1|104/111|Ribonuclease_P| GO:PFM:NREP 3 GO:PFM GO:0000049|"GO:tRNA binding"|PF00825|IPR000100| GO:PFM GO:0004526|"GO:ribonuclease P activity"|PF00825|IPR000100| GO:PFM GO:0008033|"GO:tRNA processing"|PF00825|IPR000100| RP:SCP:NREP 1 RP:SCP:REP 2->107|1a6fA|5e-12|21.9|105/113|d.14.1.2| HM:SCP:REP 2->107|1nz0A_|1.8e-20|30.8|104/109|d.14.1.2|1/1|Ribosomal protein S5 domain 2-like| OP:NHOMO 3 OP:NHOMOORG 3 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------111------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 106 STR:RPRED 98.1 SQ:SECSTR #GcccccHHHHHHHHHcEEcccccEEcEEccTTcccccccEEEEcccccccTTHHHHHHHHHHHHHHHGGGTcccccEEEEEccGGGGccTTHHHHHHTTHHHHHTc# PSIPRED ccccccHHHHHHHHHcccccccccEEEEEEEEcccccccEEEEEEEcccccHHHHHHHHHHHHHHHHHHHcccccccEEEEEccccccccHHHHHHHHHHHHHHcccc //