[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : ACD30133.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  6/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:92 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   20->81 PF09658 * Cas_Csx9 0.00024 34.4 61/377  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD30133.1 GT:GENE ACD30133.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION 18881..19159 GB:FROM 18881 GB:TO 19159 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ACD30133.1 GB:DB_XREF GI:187711836 LENGTH 92 SQ:AASEQ MKKLVKIAVAPVLALPVVASAITMDEMLKFSSEHLNNTPISEIKIDPLGITDNFYLGQEWTAGVNGKEYLCSKPGLAGFWIIGKGCQKNPFK GT:EXON 1|1-92:0| TM:NTM 1 TM:REGION 4->26| SEG 2->22|kklvkiavapvlalpvvasai| HM:PFM:NREP 1 HM:PFM:REP 20->81|PF09658|0.00024|34.4|61/377|Cas_Csx9| OP:NHOMO 6 OP:NHOMOORG 6 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111-1-1---------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 17-17,20-20,25-25,53-53,59-60,62-62,67-67| PSIPRED ccHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHcccccccEEEEccccccccEEEcccEEcccccHHEEEccccccEEEEEEccccccccc //