[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : ACD30135.1
DDBJ      :             HlyD family secretion protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  338/915 : Eukaryota  2/199 : Viruses  0/175   --->[See Alignment]
d.3.1d.41.2f.46.1
:321 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   43->282 3fppB PDBj 1e-07 23.0 %
:RPS:PDB   43->72 3bg5A PDBj 4e-05 16.7 %
:RPS:PDB   188->250 2ejmA PDBj 2e-09 15.9 %
:RPS:SCOP  39->72 1qpnA2  d.41.2.1 * 3e-04 20.6 %
:RPS:SCOP  119->307 1iu4A  d.3.1.8 * 6e-16 7.8 %
:HMM:SCOP  31->241 1vf7A_ f.46.1.1 * 7.3e-10 29.0 %
:RPS:PFM   48->266 PF00529 * HlyD 2e-10 27.3 %
:HMM:PFM   45->304 PF00529 * HlyD 8.4e-20 18.7 257/306  
:HMM:PFM   11->62 PF06480 * FtsH_ext 4e-06 20.0 50/110  
:BLT:SWISS 33->314 MDTN_ECO57 2e-20 26.4 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD30135.1 GT:GENE ACD30135.1 GT:PRODUCT HlyD family secretion protein GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION complement(21254..22219) GB:FROM 21254 GB:TO 22219 GB:DIRECTION - GB:PRODUCT HlyD family secretion protein GB:PROTEIN_ID ACD30135.1 GB:DB_XREF GI:187711838 LENGTH 321 SQ:AASEQ MKISKLMATVIILFIIIFLICVFLFFDASFERDAYLYADFTRVNSVENGQVEKIYIKKGSYVKKGDTLFVLDCRYITKELNILKSQEKKIALELKDIVIKIKLAEKQRDLTKDSLIVEKRNFERYRILIKEGAVSAQQKDLAEKSLISSESQFVRACQNVDNLKIRQNDLLSDQKITQSKIDQKQYSLSRCSVKATTNGYISNFILEEGDFIKKGQDLFSIVDTDKWYVVANVKESNIKYLSVGQIVTMTTSLTGIKKYKGKIVDIEKGITRPEYNNFSALYNIERNIDWVRLDYRFPVLIEVLSKDTKEFRLGGDVHVWF GT:EXON 1|1-321:0| BL:SWS:NREP 1 BL:SWS:REP 33->314|MDTN_ECO57|2e-20|26.4|280/343| TM:NTM 1 TM:REGION 6->28| SEG 10->26|viilfiiiflicvflff| BL:PDB:NREP 1 BL:PDB:REP 43->282|3fppB|1e-07|23.0|209/267| RP:PDB:NREP 2 RP:PDB:REP 43->72|3bg5A|4e-05|16.7|30/1137| RP:PDB:REP 188->250|2ejmA|2e-09|15.9|63/99| RP:PFM:NREP 1 RP:PFM:REP 48->266|PF00529|2e-10|27.3|198/259|HlyD| HM:PFM:NREP 2 HM:PFM:REP 45->304|PF00529|8.4e-20|18.7|257/306|HlyD| HM:PFM:REP 11->62|PF06480|4e-06|20.0|50/110|FtsH_ext| GO:PFM:NREP 3 GO:PFM GO:0008565|"GO:protein transporter activity"|PF00529|IPR006143| GO:PFM GO:0009306|"GO:protein secretion"|PF00529|IPR006143| GO:PFM GO:0016020|"GO:membrane"|PF00529|IPR006143| RP:SCP:NREP 2 RP:SCP:REP 39->72|1qpnA2|3e-04|20.6|34/115|d.41.2.1| RP:SCP:REP 119->307|1iu4A|6e-16|7.8|167/331|d.3.1.8| HM:SCP:REP 31->241|1vf7A_|7.3e-10|29.0|155/237|f.46.1.1|1/1|HlyD-like secretion proteins| OP:NHOMO 712 OP:NHOMOORG 340 OP:PATTERN -------------------------------------------------------------------- 12---------------------------------------------------------------------------------1-1341111-1-----1-12114-1-1--------------1--1-1--1-----------------11----------1----1-1--1---------------1-1------------------1---------------------2--------------------------------------------------------------------------------------------32-3------------22------1-------111-11------------11----11---225221-12-1-112121212112-11111223-1--3111-111-1-------1--1-11---33333333-222-1--------------11--1-1111111---------11---1111211-111122111111113111323--111------------1---11------------------------------11-11-212------11-11-------1-1-----------1111-11--12-2--1111-12222-1-23-2-1------------43311455445555355-455555555545555555456512222332333333333333344343344--433333333333----111112222-1223111-1-11111----454442211-1-33334343132341121322322222-1236-----221-1111-1--111------------------------------------------------------------3-- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------1---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 259 STR:RPRED 80.7 SQ:SECSTR ######################################ccEEEEccccEEccEEcccTTcEEcTTcEEEEcccTTEEEccccccccccccccTTHHHHHHHHTccccccccEEEcccTTccccHHHHHHHHHHHcEEGGGGEEEEEEEEcccTTccccGGGHHHHccccccccccccccEEEEEEEccccccccccccEEEEEEcccTTEEEccccEEEEEEccccEEEEEccccEEEEEEcccTTEEEccEEEccTTccEEEEEEEccEEEcTTccEEEccEEEEEEEcccHHHHT######################## PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHcccccccccEEEEEEEEEEEcccccEEEEEEcccccEEEcccEEEEEccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccEEEcccccEEEEEEEccccEEccccEEEEEEEcccEEEEEEEEHHHHHccccccEEEEEEEccccEEEEEEEEEEEccccccccccEEEEccccccccEEEEEEEEEEEEEEccccHHHcccccEEEEEc //