[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : ACD30138.1
DDBJ      :             soul domain protein
Swiss-Prot:             

Homologs  Archaea  4/68 : Bacteria  53/915 : Eukaryota  27/199 : Viruses  0/175   --->[See Alignment]
d.60.1
:208 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   27->205 2hc6A PDBj 3e-06 24.4 %
:RPS:PDB   92->207 1bowA PDBj 1e-07 12.7 %
:RPS:SCOP  92->207 1bowA  d.60.1.1 * 5e-08 12.7 %
:HMM:SCOP  13->208 2hvaA1 d.60.1.4 * 1.1e-46 35.1 %
:RPS:PFM   30->207 PF04832 * SOUL 7e-29 44.8 %
:HMM:PFM   27->208 PF04832 * SOUL 7.8e-56 41.2 177/180  
:BLT:SWISS 35->208 HBPL1_ARATH 2e-19 31.8 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD30138.1 GT:GENE ACD30138.1 GT:PRODUCT soul domain protein GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION complement(23711..24337) GB:FROM 23711 GB:TO 24337 GB:DIRECTION - GB:PRODUCT soul domain protein GB:PROTEIN_ID ACD30138.1 GB:DB_XREF GI:187711841 LENGTH 208 SQ:AASEQ MLKKSLSVISALALSSCSIIGINNTPQAKYTNIKKDDNFSIRIYAPLTEAQVTVQDSDYKSAVNKGFGYPFRYITGANIAKQDIQMTAPVKIEQSSQKIQMTAPVMVKGDTNNEWTIAFVLPAQYTLENAPKPTNNKVKLVEKPETKMAVITFSGFLDKDTIDSNTTKLKAWVKANNYQIVGQPEAAGYNPPWTIPFLRTNEVMIPIK GT:EXON 1|1-208:0| BL:SWS:NREP 1 BL:SWS:REP 35->208|HBPL1_ARATH|2e-19|31.8|173/309| SEG 2->22|lkkslsvisalalsscsiigi| BL:PDB:NREP 1 BL:PDB:REP 27->205|2hc6A|3e-06|24.4|168/190| RP:PDB:NREP 1 RP:PDB:REP 92->207|1bowA|1e-07|12.7|110/143| RP:PFM:NREP 1 RP:PFM:REP 30->207|PF04832|7e-29|44.8|172/180|SOUL| HM:PFM:NREP 1 HM:PFM:REP 27->208|PF04832|7.8e-56|41.2|177/180|SOUL| RP:SCP:NREP 1 RP:SCP:REP 92->207|1bowA|5e-08|12.7|110/143|d.60.1.1| HM:SCP:REP 13->208|2hvaA1|1.1e-46|35.1|185/0|d.60.1.4|1/1|Probable bacterial effector-binding domain| OP:NHOMO 105 OP:NHOMOORG 84 OP:PATTERN ------------------------------1---1----------1---1------------------ ---------------------1--1-------1111--------------1-111-----------------------------------------------------------------------1--11--1-1-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------2-11---------11---11111--------------1-------------------------11--1111-----------1------1-----------------------------11-------------------------------------11--------------------------------------1-------------------11-------1-------------------------------------1------------------------1-----------------------------------------------------------------------------------------------------------------------------------1--------------------1111-1111---------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------2-222-21-------------------------------------------1----13-------2-111-1111222222-2232----- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 181 STR:RPRED 87.0 SQ:SECSTR ##########################cccccccccccccEEEEEcccEEEEEEEEcccHHHHHHHHHHHHHHHTTTcccccccccccccccTHHHHHHTcccccEEEEEcccccccTTcccccEEEEEccccccccccEEEEEccEEEEEEEEEccHcHHHHHHHHHHHHHHHHGGGccEEEEEEEEEEEEEEEccccEEEEEEEEE# PSIPRED cHHHHHHHHHHHHHHHccEEEccccccccEEEEEEcccEEEEEEcccEEEEEEEEcccHHHHHHHHHHHHHHHHcccccccccccccccEEEEEcccccccEEEcccccccccEEEEEEEEccccccccccccccccEEEEEEcccEEEEEEEcccccHHHHHHHHHHHHHHHHcccccccccEEEEEEccccccccccEEEEEEEEc //