[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : ACD30177.1
DDBJ      :             rieske protein
Swiss-Prot:             

Homologs  Archaea  2/68 : Bacteria  198/915 : Eukaryota  29/199 : Viruses  0/175   --->[See Alignment]
b.33.1d.129.3
:298 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   7->164 3gteC PDBj 4e-16 31.8 %
:RPS:PDB   4->295 2ckfE PDBj 4e-25 16.3 %
:RPS:SCOP  7->110 1fqtA  b.33.1.1 * 1e-23 18.4 %
:HMM:SCOP  4->115 2de6A1 b.33.1.2 * 2.7e-29 35.7 %
:HMM:SCOP  94->295 1z01A2 d.129.3.3 * 5.8e-11 22.0 %
:RPS:PFM   11->83 PF00355 * Rieske 2e-10 42.5 %
:HMM:PFM   8->101 PF00355 * Rieske 3.4e-22 36.8 87/97  
:HMM:PFM   210->269 PF08417 * PaO 2.1e-05 20.3 59/93  
:HMM:PFM   181->197 PF04325 * DUF465 0.00069 41.2 17/49  
:BLT:SWISS 7->169 VANA_PSEUH 3e-15 34.2 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD30177.1 GT:GENE ACD30177.1 GT:PRODUCT rieske protein GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION 77108..78004 GB:FROM 77108 GB:TO 78004 GB:DIRECTION + GB:PRODUCT rieske protein GB:PROTEIN_ID ACD30177.1 GB:DB_XREF GI:187711880 LENGTH 298 SQ:AASEQ MKNLPKAWYAIAHIKEIKSKPIKLERLGKNLVLWKDAEKIIAMENRCPHRGAELSLGKVCDGAIACPFHGFRFDTQGNCIYTPETQGAIPKLQVKTYPTKVVADMVWINVFDEQLDSSYAFEFAQNLYNEFAGNYSLLADTWNNNIRHCIENQLDYIHLATVHKRSIGRGYKIPQDIKLNICDEYIKALKNQRLMLKYIFPNFWLLNNADKLKICVYFVPINEHQTKLYLVNYRKFLTGKIIKPIADIVFSITNKIILNEDKRVVKTQKYDEKYDTDDFLLRHDQIIKEFRKIWHTPD GT:EXON 1|1-298:0| BL:SWS:NREP 1 BL:SWS:REP 7->169|VANA_PSEUH|3e-15|34.2|155/354| BL:PDB:NREP 1 BL:PDB:REP 7->164|3gteC|4e-16|31.8|154/332| RP:PDB:NREP 1 RP:PDB:REP 4->295|2ckfE|4e-25|16.3|289/433| RP:PFM:NREP 1 RP:PFM:REP 11->83|PF00355|2e-10|42.5|73/95|Rieske| HM:PFM:NREP 3 HM:PFM:REP 8->101|PF00355|3.4e-22|36.8|87/97|Rieske| HM:PFM:REP 210->269|PF08417|2.1e-05|20.3|59/93|PaO| HM:PFM:REP 181->197|PF04325|0.00069|41.2|17/49|DUF465| GO:PFM:NREP 3 GO:PFM GO:0016491|"GO:oxidoreductase activity"|PF00355|IPR017941| GO:PFM GO:0051537|"GO:2 iron, 2 sulfur cluster binding"|PF00355|IPR017941| GO:PFM GO:0055114|"GO:oxidation reduction"|PF00355|IPR017941| RP:SCP:NREP 1 RP:SCP:REP 7->110|1fqtA|1e-23|18.4|98/109|b.33.1.1| HM:SCP:REP 4->115|2de6A1|2.7e-29|35.7|112/0|b.33.1.2|1/1|ISP domain| HM:SCP:REP 94->295|1z01A2|5.8e-11|22.0|182/0|d.129.3.3|1/1|Bet v1-like| OP:NHOMO 541 OP:NHOMOORG 229 OP:PATTERN ---------------1---1------------------------------------------------ --1-1--1111---1--11-1----21-111-11113223-23---------1---------2--1--21----------------------------------------------------------------------------7365442-23311-12-25-345751-11111-1111--------1--------------1-------------------------1--------------------------------------------------------------------------------------------1--------------------------------------------------3221-------523---2--3-------------32-22331-------1---111----111-3-----2--22222222-3341----------------------------------5R--11---4223453111144451222-17382722--311151--426154-4--------------------1------------------11-------32-------------------------------------3-------------------------------------1---------------------------------111---------------------1----------------------------------1-131---------------3323313-----2212-3-1-3113-2112--1-11-------------------22322----------1------------------------------------------1--1-2-2112-- --------------2--------------------------------------------------------------------------------------------242------------------------------------------------2111-11211--------43163324B4456-42------2 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 292 STR:RPRED 98.0 SQ:SECSTR EETTTTccEEEEEGGGcccEEEEEEETTEEEEEEEcTTcEEEEEcccTTTccccccccEEEccEEcTTTccEEcTTccEEEcTTTTTTTTGccccEEEEEEETTEEEEEcTTcccHHHHHGGGHHHHHHHHTTcEEEEEEEEcccTHHHHHHHHccTTHHHHTHHHHTccccHHHHHHHHHHHHHHHHHcHHHEEEEEETTTEEEEETTc###EEEEEEEccTTcEEEEEEEEEETTccHHHHHHHHHHHHcTTcTTGGGGHHHHHHHHHGGGcHHHEEEccTTTTcEEcccccc### DISOP:02AL 298-299| PSIPRED ccccccccEEEEEHHHcccccEEEEEccEEEEEEEEccEEEEEEEEccccccEEEEEEEcccEEEEcccccEEcccccEEEcccccccccccccEEEEEEEEccEEEEEcccccccccccccccHHHccccccccEEEEEEEcccHHHHHHccHHHHccccccHHHHccccccccccEEEEccccEEccccccEEEEEEcccEEEEEccccEEEEEEEEEcccccEEEEEEEEEcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccEEEEEEEEEEccc //