[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : ACD30188.1
DDBJ      :             hypothetical membrane protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  9/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:509 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   41->375 PF12097 * DUF3573 8e-93 63.8 %
:HMM:PFM   1->375 PF12097 * DUF3573 4.1e-183 63.4 374/383  
:BLT:SWISS 180->446 Y937_COXBU 6e-04 20.2 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD30188.1 GT:GENE ACD30188.1 GT:PRODUCT hypothetical membrane protein GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION complement(94855..96384) GB:FROM 94855 GB:TO 96384 GB:DIRECTION - GB:PRODUCT hypothetical membrane protein GB:PROTEIN_ID ACD30188.1 GB:DB_XREF GI:187711891 LENGTH 509 SQ:AASEQ MLNKINIVFICFLVLSITPFMGFSNSFKNSNEQSQKSNSIDKQGITQLQSQIANIQAEINHLTQIKNSNNSAQFATYSSKVENIGLPNSLPGNNKLTLDIMTNIDSDSSIINLSDCSIGGIFDKDGGINVGGAPAITTQGEVTFLGAYSGNNTVPIGMISSNLFASTVMGLRNKFDSYSIFFGGKIEADAQLWFGSSTISNKATNLASNGQNISLTAANLYFLSNVGHYVTAEIEFNTTELNNFSLGNAFVIFGNLDTSPFFLTAGRNKLSVGAFGGGGPWTGGITKNFLSPGKVTNVSLNYKSDVWNANVAVFGSNDNQFNFSTGLFYAQKWTQDIAVGFNTGYVYNMAGAGNPSLSRFLQSQGRPTDTIGSFNVNTNITYTIAGGFLNLGAGWATTTNKKDFTGSGKDVLAGAWYAAANYSLVFRGRKTNFGISYGESYNSTNIPMTLTASPLNFGRSSSGIQKQIIVSSQRAYFDNNVLFGPEYSYQQLYNGKHMNTITIDIAVYL GT:EXON 1|1-509:0| BL:SWS:NREP 1 BL:SWS:REP 180->446|Y937_COXBU|6e-04|20.2|253/100| TM:NTM 1 TM:REGION 4->26| SEG 23->39|fsnsfknsneqsqksns| SEG 99->118|dimtnidsdssiinlsdcsi| SEG 273->284|gafggggpwtgg| RP:PFM:NREP 1 RP:PFM:REP 41->375|PF12097|8e-93|63.8|329/374|DUF3573| HM:PFM:NREP 1 HM:PFM:REP 1->375|PF12097|4.1e-183|63.4|374/383|DUF3573| OP:NHOMO 40 OP:NHOMOORG 9 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------554344555---------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 509-510| PSIPRED cccEEEEHHHHHHHHHHcHHHccccccccccHHHHHcccHHHHcHHHHHHHHHHHHHHHHcEEEEEcccccEEEEEEEEEEcccccccccccccEEEEEEEEcccccccEEEccccccccEEcccccEEccccEEEEEccEEEEEEEEcccccEEEEEEcccHHHHHHHHHHHcccccEEEEEEEEEEEEEEEccccccccccccccccccEEEEEEEEEEEEEccccEEEEEEEEEEccccccccccEEEEEEccccccEEEEEEcccccccccccccccccHHHHHHcccccEEEEEEEEEccEEEEEEEEEccccccccccEEEEEEccccccEEEEEEEEEEEEEccccccHHHHHHHHcccccccEEEEEccccEEEEEEccEEEEEEEEEEcccccccccccccccccEEEEEEEEEEEEEEcccEEEEEEccccccccccEEEccccccccccccccEEEEEEEEEcccccccEEEccccHHHHcccccccEEEEEEEEEEc //