[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : ACD30219.1
DDBJ      :             hypothetical membrane protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  9/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:143 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   32->125 PF03899 * ATP_synt_I 1.8e-10 23.4 94/100  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD30219.1 GT:GENE ACD30219.1 GT:PRODUCT hypothetical membrane protein GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION 131476..131907 GB:FROM 131476 GB:TO 131907 GB:DIRECTION + GB:PRODUCT hypothetical membrane protein GB:PROTEIN_ID ACD30219.1 GB:DB_XREF GI:187711922 LENGTH 143 SQ:AASEQ MLIWAFLVLCESVFMNEIHVMLTNIKIDTKKFILLQLILVLVGYFVILVFYNYDYANSFLIGSLTMFLANFVFFFRLFINKQFSPGIEIAIFYLSELLKLSIVALLTILLAIYVKPKLFSYIFGLVLLQLAVCFVPILFKRVR GT:EXON 1|1-143:0| TM:NTM 5 TM:REGION 1->23| TM:REGION 32->52| TM:REGION 58->80| TM:REGION 89->111| TM:REGION 118->139| SEG 67->78|flanfvfffrlf| HM:PFM:NREP 1 HM:PFM:REP 32->125|PF03899|1.8e-10|23.4|94/100|ATP_synt_I| OP:NHOMO 9 OP:NHOMOORG 9 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111111111---------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 67-67,73-73| PSIPRED cHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHcc //