[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : ACD30229.1
DDBJ      :             glutaredoxin-related protein
Swiss-Prot:             

Homologs  Archaea  8/68 : Bacteria  467/915 : Eukaryota  192/199 : Viruses  0/175   --->[See Alignment]
c.47.1
:109 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   10->105 1ykaA PDBj 1e-38 66.7 %
:RPS:PDB   7->108 3d5jB PDBj 3e-19 19.6 %
:RPS:SCOP  7->105 1wikA  c.47.1.1 * 1e-17 32.3 %
:HMM:SCOP  6->106 1wikA_ c.47.1.1 * 3e-31 39.6 %
:RPS:PFM   22->86 PF00462 * Glutaredoxin 3e-07 36.7 %
:HMM:PFM   22->86 PF00462 * Glutaredoxin 2.6e-18 28.3 60/60  
:BLT:SWISS 10->105 GLRX4_SHIFL 3e-38 66.7 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD30229.1 GT:GENE ACD30229.1 GT:PRODUCT glutaredoxin-related protein GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION complement(141545..141874) GB:FROM 141545 GB:TO 141874 GB:DIRECTION - GB:PRODUCT glutaredoxin-related protein GB:PROTEIN_ID ACD30229.1 GB:DB_XREF GI:187711932 LENGTH 109 SQ:AASEQ MYTPEEQKVVERIEKQLKENDIILYMKGSPNLPQCGFSAHAATAIRSCGKPFAFVNILENPDIRAILPKYADWPTFPQLWVKGELIGGCDIIMEMNESGELKKLIDSVK GT:EXON 1|1-109:0| BL:SWS:NREP 1 BL:SWS:REP 10->105|GLRX4_SHIFL|3e-38|66.7|96/115| BL:PDB:NREP 1 BL:PDB:REP 10->105|1ykaA|1e-38|66.7|96/115| RP:PDB:NREP 1 RP:PDB:REP 7->108|3d5jB|3e-19|19.6|97/107| RP:PFM:NREP 1 RP:PFM:REP 22->86|PF00462|3e-07|36.7|60/60|Glutaredoxin| HM:PFM:NREP 1 HM:PFM:REP 22->86|PF00462|2.6e-18|28.3|60/60|Glutaredoxin| GO:PFM:NREP 3 GO:PFM GO:0009055|"GO:electron carrier activity"|PF00462|IPR002109| GO:PFM GO:0015035|"GO:protein disulfide oxidoreductase activity"|PF00462|IPR002109| GO:PFM GO:0045454|"GO:cell redox homeostasis"|PF00462|IPR002109| RP:SCP:NREP 1 RP:SCP:REP 7->105|1wikA|1e-17|32.3|99/109|c.47.1.1| HM:SCP:REP 6->106|1wikA_|3e-31|39.6|101/0|c.47.1.1|1/1|Thioredoxin-like| OP:NHOMO 992 OP:NHOMOORG 667 OP:PATTERN ------------------------11111111------------------------------------ --------------------------------------------------------------------------------------------------------------------------------------------------1111111111111111111111111111111111111-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111111111111221111111111111111111-1111111111111111111111112211111111111111111111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111-1112111111111111111111111111111---------------------------12---------------------------111111111111111111111111111111111-1111111111111111111111111111-111111111111111111111111111111111111111111111111111111111111111111111111111111211111111111111111111111111111211111111111111211111111111111111111111111122222222222222111-111111------------------------------------------------- 3311222-93312231222222222222222222222212221222122233221222222221222222341223322322222222-232222232222223221272412212-21-2221222423C2-235111-12222211-121222232222422222212723532435Q4444485A62453342233 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 104 STR:RPRED 95.4 SQ:SECSTR #####ccHHHHHHHHHHHHccEEEEEcccccHTTcHHHHHHHHHHTTccccGGGEEEEEHHHHHHHHHHHHccccccEEEETTEEEEcHHHHHHHHHHcHHHHHHTTTH PSIPRED cccHHHHHHHHHHHHHHHHccEEEEEcccccccccHHHHHHHHHHHHcccccEEEEccccHHHHHHHHHHHccccccEEEEccEEEccHHHHHHHHHcccHHHHHHHcc //