[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : ACD30231.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:62 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   7->62 PF01943 * Polysacc_synt 0.00032 32.1 56/273  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD30231.1 GT:GENE ACD30231.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION 142600..142788 GB:FROM 142600 GB:TO 142788 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID ACD30231.1 GB:DB_XREF GI:187711934 LENGTH 62 SQ:AASEQ MAKNKISLFYFVIGVLSIVVVILIAVLFPGLRLSAIFRNILLIILLLPWIVFMLSLLFSGKE GT:EXON 1|1-62:0| TM:NTM 2 TM:REGION 5->27| TM:REGION 37->58| SEG 12->27|vigvlsivvviliavl| SEG 40->47|illiilll| HM:PFM:NREP 1 HM:PFM:REP 7->62|PF01943|0.00032|32.1|56/273|Polysacc_synt| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 17-17| PSIPRED cccHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccc //