[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : ACD30251.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  11/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:173 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   61->106 PF07316 * DUF1463 0.00029 32.6 46/140  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD30251.1 GT:GENE ACD30251.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION 174285..174806 GB:FROM 174285 GB:TO 174806 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ACD30251.1 GB:DB_XREF GI:187711954 LENGTH 173 SQ:AASEQ MEEKTIYRGINVTIVTKHLVQIERPSKLLEILFYKYVFKHQTYADLALEYGKTKRWAYDQIHSYEVAKKEHNPRAVTLLCDTTFYGKRKDKLATVVFCDTIENEVLLWRHVDSEKSKYYKEMLQQLLSLGYTVNAVTIDGKRGLNTVKVCPIQMCHFHQKIVDRYIVNPRVFC GT:EXON 1|1-173:0| HM:PFM:NREP 1 HM:PFM:REP 61->106|PF07316|0.00029|32.6|46/140|DUF1463| OP:NHOMO 36 OP:NHOMOORG 11 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------8A8--2-----1-----------2---------------------111--1-1---------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 39-39,45-46,48-48,53-53,67-88,173-174| PSIPRED cccccEEcccEEEEEEEHHHccccHHHHHHHHHHHHHHHcccHHHHHHHHcccccccHHHHHHHHHHHccccccEEEEEEEccccccccccEEEEEEEEccccHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEEEEccHHHHHHHHHccHHHHHHHHHHHHHHcccccccc //