[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : ACD30253.1
DDBJ      :             transposase, IS4 family protein
Swiss-Prot:             

Homologs  Archaea  1/68 : Bacteria  11/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.55.3
:193 amino acids
:PSIPRED
:HMM:SCOP  30->155 1musA_ c.55.3.4 * 2.1e-05 12.4 %
:HMM:PFM   131->177 PF03837 * RecT 0.00063 10.6 47/199  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD30253.1 GT:GENE ACD30253.1 GT:PRODUCT transposase, IS4 family protein GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION complement(179561..180142) GB:FROM 179561 GB:TO 180142 GB:DIRECTION - GB:PRODUCT transposase, IS4 family protein GB:PROTEIN_ID ACD30253.1 GB:DB_XREF GI:187711956 LENGTH 193 SQ:AASEQ MDKDVLDIYTDYLINQTKYATATKLSDILDQEVSHDKITRFLSKPYLTSLEFWKYIKPLVKKHNSEYEVLCLDDTISEKPSTDENDIVCWHHSHAKGVHVKGINIVSCILSTSNLSIPIDYEIVKKYKRYYDEKDKRYKRRSKITKNQMFQNMINRAVINQVKFKYILTSVRQLFHRQTLRIIDFNWVNNKLS GT:EXON 1|1-193:0| SEG 125->143|kkykryydekdkrykrrsk| HM:PFM:NREP 1 HM:PFM:REP 131->177|PF03837|0.00063|10.6|47/199|RecT| HM:SCP:REP 30->155|1musA_|2.1e-05|12.4|121/0|c.55.3.4|1/1|Ribonuclease H-like| OP:NHOMO 14 OP:NHOMOORG 12 OP:PATTERN -----------------------------------------------1-------------------- -------------------------------------------------------------------------------------------------------------------------------------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------3------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------------------------------11111111---------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PSIPRED ccHHHHHHHHHHHHHcccccHHHHHHHHcccccHHHHHHHHHHcccccHHHHHHHHHHcccccccccEEEEEEcccccccccccccEEEEEEccccccEEEEEEEEEEEEEEcccEEEEEEEEEccccccccHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHcEEEEEEEccccccc //