[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : ACD30262.1
DDBJ      :             type III pantothenate kinase 1
Swiss-Prot:COAX1_FRATT  RecName: Full=Type III pantothenate kinase 1;         EC=2.7.1.33;AltName: Full=Pantothenic acid kinase 1;AltName: Full=PanK-III 1;

Homologs  Archaea  0/68 : Bacteria  341/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
c.55.1
:258 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->253 3djcC PDBj 3e-59 46.2 %
:RPS:PDB   1->253 3djcC PDBj 9e-72 45.8 %
:RPS:SCOP  1->117 2gtdA1  c.55.1.13 * 2e-09 27.4 %
:RPS:SCOP  124->249 2f9tA1  c.55.1.13 * 2e-31 32.2 %
:HMM:SCOP  1->122 2gtdA1 c.55.1.13 * 1.3e-28 33.9 %
:HMM:SCOP  124->252 2gtdA2 c.55.1.13 * 4.2e-32 38.6 %
:RPS:PFM   2->207 PF03309 * Bvg_acc_factor 5e-35 42.5 %
:HMM:PFM   2->205 PF03309 * Bvg_acc_factor 1.1e-53 34.5 197/206  
:BLT:SWISS 1->258 COAX1_FRATT e-146 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD30262.1 GT:GENE ACD30262.1 GT:PRODUCT type III pantothenate kinase 1 GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION 193613..194389 GB:FROM 193613 GB:TO 194389 GB:DIRECTION + GB:PRODUCT type III pantothenate kinase 1 GB:PROTEIN_ID ACD30262.1 GB:DB_XREF GI:187711965 LENGTH 258 SQ:AASEQ MLLVMDMGNSHIHIGVFDGDRIVSQIRYATSSVDSTSDQMGVFLRQALRENSVDLGKIDGCGISSVVPHLNYSLGSAVIKYFNIKPFFISMDTTDLDMSAVEAHQVGADRIASCISAIADHPNKDLLIIDLGTATTFDLVTKDKKYLSGSIMPGVKLSLNALCQGASQLSSVTIVKPEVAIGYDTKTNIRSGLYYGHLGALKELKRRSVEEFGSPVYTIATGGFAGLFKEEDIFNEISPDLILRGIRIAFLENNKKGV GT:EXON 1|1-258:0| SW:ID COAX1_FRATT SW:DE RecName: Full=Type III pantothenate kinase 1; EC=2.7.1.33;AltName: Full=Pantothenic acid kinase 1;AltName: Full=PanK-III 1; SW:GN Name=coaX1; OrderedLocusNames=FTT0112; SW:KW ATP-binding; Coenzyme A biosynthesis; Complete proteome; Cytoplasm;Kinase; Metal-binding; Nucleotide-binding; Transferase. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->258|COAX1_FRATT|e-146|100.0|258/258| GO:SWS:NREP 7 GO:SWS GO:0005524|"GO:ATP binding"|ATP-binding| GO:SWS GO:0015937|"GO:coenzyme A biosynthetic process"|Coenzyme A biosynthesis| GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0016301|"GO:kinase activity"|Kinase| GO:SWS GO:0046872|"GO:metal ion binding"|Metal-binding| GO:SWS GO:0000166|"GO:nucleotide binding"|Nucleotide-binding| GO:SWS GO:0016740|"GO:transferase activity"|Transferase| BL:PDB:NREP 1 BL:PDB:REP 1->253|3djcC|3e-59|46.2|251/256| RP:PDB:NREP 1 RP:PDB:REP 1->253|3djcC|9e-72|45.8|251/256| RP:PFM:NREP 1 RP:PFM:REP 2->207|PF03309|5e-35|42.5|200/203|Bvg_acc_factor| HM:PFM:NREP 1 HM:PFM:REP 2->205|PF03309|1.1e-53|34.5|197/206|Bvg_acc_factor| GO:PFM:NREP 2 GO:PFM GO:0016563|"GO:transcription activator activity"|PF03309|IPR004619| GO:PFM GO:0045941|"GO:positive regulation of transcription"|PF03309|IPR004619| RP:SCP:NREP 2 RP:SCP:REP 1->117|2gtdA1|2e-09|27.4|113/118|c.55.1.13| RP:SCP:REP 124->249|2f9tA1|2e-31|32.2|121/125|c.55.1.13| HM:SCP:REP 1->122|2gtdA1|1.3e-28|33.9|118/0|c.55.1.13|1/1|Actin-like ATPase domain| HM:SCP:REP 124->252|2gtdA2|4.2e-32|38.6|127/0|c.55.1.13|1/1|Actin-like ATPase domain| OP:NHOMO 359 OP:NHOMOORG 342 OP:PATTERN -------------------------------------------------------------------- 11111---------11111-111111111111111111111111----------------111-1111111111111111211--11111111111---111111-1211---------------11111111111---1111111---------11--------------------------11111111-11111111111111111111111111111111111111111------------------------------------------------------------------------------------------11111111111111111111111111212112111121111111111111-2-1111--------------------------------------------------------1111111111111111111111--1111111111111---------------------111111-----111111-----11--------11---------------------1---------------------11111111111111111111111111111111-------------------------11------11-1----------------------1-1-1--------------------------------------------------------------------------------------------------1111--1-----------------------1----------------------2222222221------------------------------1111111111111111-11------------------1------1111111111111 -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 254 STR:RPRED 98.4 SQ:SECSTR cEEEEEEcccEEEEEEEETTEEEEEEEEEcccccccHHHHHHHHHHHHHHTTccGGGccEEEEEEccTTTHHHHHHHHHHHTccccEEccTTccccEEccccTTcccHHHHHHHHHHHHHcTTcEEEEEEEccEEEEEEEcTTcEEEEEEEEEcHHHHHHHHHHccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHTTccEEEEEEEccGGGGTTTTcccEEcTTHHHHHHHHHHHTTc#### DISOP:02AL 258-259| PSIPRED cEEEEEcccccEEEEEEEccEEEEEEEcccccccccHHHHHHHHHHHHHHccccHHHccEEEEEEcccHHHHHHHHHHHHHHcccEEEEcccccccccccccHHHccHHHHHHHHHHHHHcccccEEEEEccccEEEEEEcccccEEEEEEccHHHHHHHHHHHHHccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccEEEEEcccHHHHHccccccEEccccHHHHHHHHHHHHccccc //