[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : ACD30272.1
DDBJ      :             ABC-type oligopeptide transport system, periplasmic component
Swiss-Prot:             

Homologs  Archaea  29/68 : Bacteria  707/915 : Eukaryota  4/199 : Viruses  0/175   --->[See Alignment]
c.94.1
:522 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   19->506 1b0hA PDBj 7e-85 37.3 %
:RPS:PDB   20->520 1b52A PDBj 2e-85 32.4 %
:RPS:SCOP  20->520 1b05A  c.94.1.1 * 9e-86 34.0 %
:HMM:SCOP  20->521 1jetA_ c.94.1.1 * 3.4e-119 31.3 %
:RPS:PFM   73->459 PF00496 * SBP_bac_5 2e-48 34.9 %
:HMM:PFM   72->465 PF00496 * SBP_bac_5 7.8e-78 30.4 359/372  
:BLT:SWISS 19->506 OPPA_SALTY 2e-84 37.3 %
:PROS 78->100|PS01040|SBP_BACTERIAL_5

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD30272.1 GT:GENE ACD30272.1 GT:PRODUCT ABC-type oligopeptide transport system, periplasmic component GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION 205907..207475 GB:FROM 205907 GB:TO 207475 GB:DIRECTION + GB:PRODUCT ABC-type oligopeptide transport system, periplasmic component GB:PROTEIN_ID ACD30272.1 GB:DB_XREF GI:187711975 LENGTH 522 SQ:AASEQ MASVLILPGCSNDSDNNIDPYAGQLTKNNNQLVVNIGSDMPSIDPQQSSDNSSSRVIEDIFQGLVDYNQKSEVIPTGASSWKISKDGKTYTFYLRKNAKWTNGDPVTADDYVYSYRRSVTPETLTRAYASYFNPIVNAVAIQAGKKSPETLGVKALDKYTLQIKLTEPNPTFLDSLTIYAFFPVNKKAIEKYGDSWAAKPDTIISNGAYKLTKWIHNGYALAEKSSNYWDAKNVSIDSVKYLMINDVSSDLENYKAGGESLTYNNLPANTAEWYKEHFTNNQFQPSPMLAQAYFIFNMRDTKFQDIRVRKALSMVIDRKGIAEGVKKGLVTSSYLVVPETVAGGRYKDLAKDIPDYDWVNEPIEQRIKQARQLLKEAGYSKKHPLEFTINFNTSDVNRLMAQILQGSWQQDFGDLVKVSIFNEDWKVYLDSLKNGNFDVARMAWIADFNQPNTYTEMYTCDSDNNYGHYCDKEADEIYNKSLTTNSMDEFYKLQKELIIKQTAGYPTIPLFTQPTYSLYNRM GT:EXON 1|1-522:0| BL:SWS:NREP 1 BL:SWS:REP 19->506|OPPA_SALTY|2e-84|37.3|475/543| PROS 78->100|PS01040|SBP_BACTERIAL_5|PDOC00799| BL:PDB:NREP 1 BL:PDB:REP 19->506|1b0hA|7e-85|37.3|475/517| RP:PDB:NREP 1 RP:PDB:REP 20->520|1b52A|2e-85|32.4|487/515| RP:PFM:NREP 1 RP:PFM:REP 73->459|PF00496|2e-48|34.9|358/366|SBP_bac_5| HM:PFM:NREP 1 HM:PFM:REP 72->465|PF00496|7.8e-78|30.4|359/372|SBP_bac_5| GO:PFM:NREP 2 GO:PFM GO:0005215|"GO:transporter activity"|PF00496|IPR000914| GO:PFM GO:0006810|"GO:transport"|PF00496|IPR000914| RP:SCP:NREP 1 RP:SCP:REP 20->520|1b05A|9e-86|34.0|488/517|c.94.1.1| HM:SCP:REP 20->521|1jetA_|3.4e-119|31.3|489/0|c.94.1.1|1/1|Periplasmic binding protein-like II| OP:NHOMO 3146 OP:NHOMOORG 740 OP:PATTERN 221-------------1-1111-121132-21-1---------1-2--1-852-2121--1---2--- 11--2322333-2-21111-11--161111111111-313-31954232-1134331211561221445A-53336542-1-311111--------2--------11--12222222444444411--1-111131122312215A4212221221111111-31132243--1111111111C4722551423EFGFHCGG9FFHDDFB95562IFG314B864655546W613333334343333422221D8B7686-33377--77222244455333233341134433333334-1111111111116--44311121836255544642532233422232223A-1-1774311181-3371178111----1411521DEM--35426-6779789688M-23621516FF--aIIKAC6HFDGJD3-12-458587176--------1--11-65--------------------------------1--BBA9A88888856666769966662686D5365--445-123252838E13--21-72-------------224111141231121111111211----261111-1-11111111111111112-11--772-12111141111111111111111111--121--------88EE4A88888887868-88878877778877888859AAED6665545555555555556B66766574-544455545555---1----------1626777224444436355222222--14225555463834664-9891-21-11--122254444446344-----------------G1111--5552521251-1------------------------2231248434241 -------------1------------------------------------------------------------------------------------------------------------------------------------------------1----2---------------------1------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 503 STR:RPRED 96.4 SQ:SECSTR ##################EccTTcccccccEEEEEcccccccccGGGcccHHHHHHHHHHccccEEEcTTccEEEccEEEEEEEETTTEEEEEEcTTcccTTcccccHHHHHHHHHHHHcGGGccTTTHHHHHTcTTHHHHHTTcccGGGccEEEEETTEEEEEcccccTTGGGGGGcGGGccccHHHHHHHGGGTTHcTTTccccccEEEEEEETTTEEEEEEcTTcTTGGGccccEEEEEccccHHHHHHHHHTTcccccccccccTTHHHHHHHcTTTTEEEEEEEEEEEEEEcTTcTTTTcHHHHHHHHHHccHHHHHHTTTccccEEccccccTTcTTccccccHHHHccHHHTHccHHHHHHHHHHHHHHTTcccccEEEEEEEEccHHHHHHHHHHHHHHHHHHccETEEEEEEEEcHHHHHHHHHHTcccEEEEEEEcccccTHHHHGGGcTTcTTcTTccccHHHHHHHHGGGccccHHHHHHHHHHHHHHHHHTTcEEEEEEEEEEEEccT# DISOP:02AL 522-523| PSIPRED cHHHHHHHHHccccccccccccccccccccEEEEEEcccccccccEEEcccHHHHHHHHHHHHHEEEcccccEEEEEEEEEEEcccccEEEEEEccccEEcccccccHHHHHHHHHHHHcccccccHHHHHHHHHccHHHHHcccccccccEEEEccccEEEEEEccccHHHHHHHccccEEEccHHHHHHcccccccccccccEEccEEEEEEEcccEEEEEEcccccccccccEEEEEEEEEccHHHHHHHHHcccEEEEEccccHHHHHHHHHcccccEEEEccccEEEEEEEcccccccccHHHHHHHHHHHcHHHHHHHHHHcccEEEcccccccccccccccccccccccccccccccccHHHHHHHHHHcccccccEEEEEEEEcccccHHHHHHHHHHHHHHHccccEEEEEEEccHHHHHHHHHcccccEEEEEcccccccHHHHHHHHcccccccccccccHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHcccEEEEEEccEEEEEEcc //