[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : ACD30275.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  9/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:193 amino acids
:PSIPRED

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD30275.1 GT:GENE ACD30275.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION 212662..213243 GB:FROM 212662 GB:TO 213243 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ACD30275.1 GB:DB_XREF GI:187711978 LENGTH 193 SQ:AASEQ MKKVITFSALFLCSIFGYSDNNLNQQTGMYYITANNFFYRPSTERGNEVVDRQNSSEFSDRISSSAINITDSLVFDAYTSSTSLIAQGSMGDLKDTKFYTQETKLVKKLWNDKLEIYGGTVLGANPYQLNNINSAYDPGSRIAAFASGRTGAKYNVSRNFGLLIEGQYNLTGEMADNTDMFTGFNGAQYRTQL GT:EXON 1|1-193:0| OP:NHOMO 9 OP:NHOMOORG 9 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111111111---------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PSIPRED ccEEEEHHHHHHHHHHcccccccccccEEEEEEcccEEEcccccccHHHHHcccHHHHHHHHccccEEcccEEEEEEEccccEEEEEcccccccccHHHHHHHHHHHHHHcccEEEEccEEEcccccEEccccccccccccEEEEcccccccEEEEcccEEEEEEEccccEEEEcccccEEEccccccEEEcc //