[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : ACD30280.1
DDBJ      :             hypothetical membrane protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  9/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:237 amino acids
:PSIPRED
:DISOPRED
:BLT:SWISS 103->217 OR5B3_HUMAN 5e-04 34.7 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD30280.1 GT:GENE ACD30280.1 GT:PRODUCT hypothetical membrane protein GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION 219593..220306 GB:FROM 219593 GB:TO 220306 GB:DIRECTION + GB:PRODUCT hypothetical membrane protein GB:PROTEIN_ID ACD30280.1 GB:DB_XREF GI:187711983 LENGTH 237 SQ:AASEQ MCEITFIPLLADDVLRLFISFILFLSCVILSYIFAKQKPWDIAFWICFSIFLFSMGGYGYIIHHIYLENTFSYDGFISGAAFITVCGLLFSRKRYINFADSFVNKNTAILIATFVVFALIYILTIRYNFSCVEEPHQFFIDALQIVIYPLLLLFAITAFLYRFAICLSAFAVSMALFIIENILFIAHAIAAQHKYDIVFEEVLFATISIVLSAIAVYILTRAKRIYKENSDVRSIRQ GT:EXON 1|1-237:0| BL:SWS:NREP 1 BL:SWS:REP 103->217|OR5B3_HUMAN|5e-04|34.7|95/100| TM:NTM 7 TM:REGION 8->30| TM:REGION 39->61| TM:REGION 70->91| TM:REGION 103->125| TM:REGION 136->158| TM:REGION 166->188| TM:REGION 198->220| SEG 15->31|lrlfisfilflscvils| OP:NHOMO 9 OP:NHOMOORG 9 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111111111---------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 31-31,34-34,39-39,45-45,87-88,90-90,95-96,101-101,104-104,109-109,115-115,118-118,123-123,157-157,160-160,165-165,171-172,174-174,207-207,213-213| PSIPRED cccEEEHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHccHHHHHHHEEccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHc //