[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : ACD30291.1
DDBJ      :             hypothetical membrane protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  9/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:78 amino acids
:PSIPRED
:HMM:PFM   16->68 PF06305 * DUF1049 3.3e-14 34.0 53/80  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD30291.1 GT:GENE ACD30291.1 GT:PRODUCT hypothetical membrane protein GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION 236036..236272 GB:FROM 236036 GB:TO 236272 GB:DIRECTION + GB:PRODUCT hypothetical membrane protein GB:PROTEIN_ID ACD30291.1 GB:DB_XREF GI:187711994 LENGTH 78 SQ:AASEQ MFDMLAKLFWQIFFGILIILIVILSILNTDKVSFDYIFGTTTLPLIVLMSIAFVLGLLLGSFITKFIQITKTSGGAKK GT:EXON 1|1-78:0| TM:NTM 2 TM:REGION 7->29| TM:REGION 43->65| SEG 8->27|lfwqiffgiliilivilsil| HM:PFM:NREP 1 HM:PFM:REP 16->68|PF06305|3.3e-14|34.0|53/80|DUF1049| OP:NHOMO 9 OP:NHOMOORG 9 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111111111---------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PSIPRED cHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccc //