[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : ACD30305.1
DDBJ      :             drug:H+ antiporter-1 (DHA1) family protein
Swiss-Prot:             

Homologs  Archaea  6/68 : Bacteria  497/915 : Eukaryota  87/199 : Viruses  0/175   --->[See Alignment]
f.38.1
:393 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   19->181 2gfpA PDBj 7e-14 39.3 %
:RPS:SCOP  43->342 1pv6A  f.38.1.2 * 4e-06 14.5 %
:HMM:SCOP  1->393 1pw4A_ f.38.1.1 * 4.9e-55 22.0 %
:RPS:PFM   11->155 PF07690 * MFS_1 3e-09 29.7 %
:HMM:PFM   13->349 PF07690 * MFS_1 1.2e-42 23.5 327/353  
:BLT:SWISS 9->391 BCR_HAEIN 3e-28 25.8 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD30305.1 GT:GENE ACD30305.1 GT:PRODUCT drug:H+ antiporter-1 (DHA1) family protein GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION complement(251543..252724) GB:FROM 251543 GB:TO 252724 GB:DIRECTION - GB:PRODUCT drug:H+ antiporter-1 (DHA1) family protein GB:PROTEIN_ID ACD30305.1 GB:DB_XREF GI:187712008 LENGTH 393 SQ:AASEQ MYKGIRPSIFILILMVSLGPFGDTIYAPALPELKTILGTDYPHVQLTITSYLLGYSISQLLYGPFSDRFGRKPVMLVGTCFFIISSIICIFSNHINTLIYARMIQGFGAAAGGVIATVAVKDAFKVNEQGAVFAIMNIAFALAPAFGAVLGVFLSPTAIFWVLLVAASILFIKVAIFFPETIREKNFEDLTFKSFFKNYFLLFKDHQFFFATFVLGINISVIYACLVTAPDIFVNILKLEKSNFLYLLTIMVTAVVLGSIVCSKLSRIIAYKHLVNFGMFCTLISGVLCIYAFKKLTGLELSIALTAILSLTFIGVSFSVPLLTPIALENFTTTAGAASSVMGFMQMGIASITTAIMSQISLGSEFTLSFAFVILPLIGLTIFLPYSCYFLKK GT:EXON 1|1-393:0| BL:SWS:NREP 1 BL:SWS:REP 9->391|BCR_HAEIN|3e-28|25.8|364/398| TM:NTM 12 TM:REGION 2->24| TM:REGION 46->68| TM:REGION 73->95| TM:REGION 104->126| TM:REGION 131->153| TM:REGION 161->183| TM:REGION 213->235| TM:REGION 242->264| TM:REGION 272->293| TM:REGION 302->324| TM:REGION 336->358| TM:REGION 367->389| SEG 80->92|cffiissiicifs| SEG 108->120|gaaaggviatvav| BL:PDB:NREP 1 BL:PDB:REP 19->181|2gfpA|7e-14|39.3|163/375| RP:PFM:NREP 1 RP:PFM:REP 11->155|PF07690|3e-09|29.7|145/347|MFS_1| HM:PFM:NREP 1 HM:PFM:REP 13->349|PF07690|1.2e-42|23.5|327/353|MFS_1| GO:PFM:NREP 1 GO:PFM GO:0055085|"GO:transmembrane transport"|PF07690|IPR011701| RP:SCP:NREP 1 RP:SCP:REP 43->342|1pv6A|4e-06|14.5|297/417|f.38.1.2| HM:SCP:REP 1->393|1pw4A_|4.9e-55|22.0|387/447|f.38.1.1|1/1|MFS general substrate transporter| OP:NHOMO 1433 OP:NHOMOORG 590 OP:PATTERN --------------------------------------------1-1-1-111--------------- ----1112112-11-----------1-------2221233----122-221-1122-----1------1-2------------1----22----------11-1-313---------------------------1---------1---------------------------------------------1-22222234222222322-22-1222---2-1111111233122222222222222322211-1--------11----1-2-----------------------------------------------------1----------1--11--------------12------------------2111-1312--2221111211212222122223-11111211422172236535563423111233-1--22222222222-11211-1111111111122-1221-1--1--11111-1-211122232333333222222112222134321212--11232232312231122-21321----------2-1122--11---1----11--1--2111-11---2111-1111-1----------111---32312--11121444443144341422433-------------53121544554444444-54345444445544444444444566544344444444444442325233121333333323333--31443435565--235111212-111111122222321111212222133413132111175767866514454555657765511-1-11---------1------------------------------------------------------1- --------------12361577637582223-354122121121114348358612333223-1312332123221----2325122--552324244324-3623---------------------------------------------------------1------1----------------1-4--------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 163 STR:RPRED 41.5 SQ:SECSTR ##################HHHHHHHHHHHHHHHHTTcccTTHHHHHHHHHHHHHHHHHHTTHHHHHTTcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTcccccHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHcccccccccc#################################################################################################################################################################################################################### PSIPRED cccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHcc //