[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : ACD30307.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  65/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.118.8
:212 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   112->198 1na0A PDBj 3e-04 33.3 %
:RPS:PDB   109->210 2cfuA PDBj 5e-09 4.0 %
:RPS:SCOP  109->207 1w3bA  a.118.8.1 * 7e-09 14.6 %
:HMM:SCOP  105->212 1iygA_ a.118.8.1 * 2.1e-08 18.1 %
:HMM:PFM   167->192 PF00515 * TPR_1 5.8e-06 42.3 26/34  
:BLT:SWISS 30->210 YFGM_ECOLI 7e-11 31.1 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD30307.1 GT:GENE ACD30307.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION complement(254097..254735) GB:FROM 254097 GB:TO 254735 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ACD30307.1 GB:DB_XREF GI:187712010 LENGTH 212 SQ:AASEQ MKNLSKKQTQALYTIAGIIIVAIICAIFLQFYNSSNDKKMLEASTIYQKALIANENPKSSVETKIAKFEQVVNDYPNTSFGIFASWQLADLYTTPTKPDSKNFNVNITNLPKAIVILQQSIENNPKDSLSDISKVRLARLYIVAKQPDQAIKTLQGIKSFKDNAYPLMLLGQAYSEKKDKVKAIESWQKALQDPNSSDQFKQIISQLINNTN GT:EXON 1|1-212:0| BL:SWS:NREP 1 BL:SWS:REP 30->210|YFGM_ECOLI|7e-11|31.1|164/206| TM:NTM 1 TM:REGION 11->32| SEG 15->27|iagiiivaiicai| BL:PDB:NREP 1 BL:PDB:REP 112->198|1na0A|3e-04|33.3|84/119| RP:PDB:NREP 1 RP:PDB:REP 109->210|2cfuA|5e-09|4.0|99/627| HM:PFM:NREP 1 HM:PFM:REP 167->192|PF00515|5.8e-06|42.3|26/34|TPR_1| RP:SCP:NREP 1 RP:SCP:REP 109->207|1w3bA|7e-09|14.6|96/388|a.118.8.1| HM:SCP:REP 105->212|1iygA_|2.1e-08|18.1|105/133|a.118.8.1|1/1|TPR-like| OP:NHOMO 65 OP:NHOMOORG 65 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-----1111111111-1111111111111111111111-----1111111111111111-1111111----------------------------------------------------------------------------111111111---------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 134 STR:RPRED 63.2 SQ:SECSTR ################################################################HHTTTcccGGGccHHHHHHHHHHTTccc############EEEccHHHHHHHHHHHHHHcTTcHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHccccccccHHHHHHccHHHHHHHHHHHcHHHHTTccEEEEEEETT## PSIPRED cccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHcccHHHHHHHHccccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHcccc //