[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : ACD30314.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:Y239_FRATM   RecName: Full=UPF0246 protein FTM_0239;

Homologs  Archaea  0/68 : Bacteria  386/915 : Eukaryota  14/199 : Viruses  0/175   --->[See Alignment]
:254 amino acids
:PSIPRED
:RPS:PFM   1->245 PF03883 * DUF328 4e-48 43.2 %
:HMM:PFM   1->244 PF03883 * DUF328 4.5e-85 48.1 235/237  
:BLT:SWISS 1->254 Y239_FRATM e-146 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD30314.1 GT:GENE ACD30314.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION 262795..263559 GB:FROM 262795 GB:TO 263559 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ACD30314.1 GB:DB_XREF GI:187712017 LENGTH 254 SQ:AASEQ MIIVISPAKSQNFEPIKTAYQFTQPIFKQQIIKLINTLKHYEVEEIEKLMKISPKLAEEVFAKHNSFNPNKYDNSNAKAAIFTFSGDVYKGLEADTLDNKTIEYAQNHLLMLSGLYGLVRPLDLIQAYRLEMGTNIKIDGKILHKYWQDKITTQLNEYFSQQQNKILINLASNEYSQAIDKKSLAVKWLDIDFKENKAGAYKTIGIHAKKARGLITRYILENRIENVSDIKKFNVAGYQFNPDFSDENLLCFTR GT:EXON 1|1-254:0| SW:ID Y239_FRATM SW:DE RecName: Full=UPF0246 protein FTM_0239; SW:GN OrderedLocusNames=FTM_0239; SW:KW Complete proteome. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->254|Y239_FRATM|e-146|100.0|254/254| RP:PFM:NREP 1 RP:PFM:REP 1->245|PF03883|4e-48|43.2|234/239|DUF328| HM:PFM:NREP 1 HM:PFM:REP 1->244|PF03883|4.5e-85|48.1|235/237|DUF328| OP:NHOMO 404 OP:NHOMOORG 400 OP:PATTERN -------------------------------------------------------------------- -----1------------------------------------------1-----------11------------------11------1111-111---111111-----------------------------------------11----------------------------------------------------------------------------------------------------------1111111111111111-11------11111111111111111111111111111111111--1111111----1-------1-1-1---1111--11-11--11-------------11---1111--------------------------------------------------------1-111-1111111----------------------------1-11-11-1-11--------1--111111111111-111111111111111111111111111111111111111----111111111---111--1-1-----1---------------------1-1--11111----------1------111111111111111111111111111111-------------11111111111111111-1111111111111111111111111111111111111111111111111111-111111111111--1------1111-1111111111-1111111121111111111111111111111111111111111111111111111111111----------------1-----------------1----------------1-1------------------- ------1-----------------------------------------------------------------------------------------------------2----------------------------------------------------------------2----12111---------111111- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PSIPRED cEEEEcccHHccccccccccccccHHHHHHHHHHHHHHHHccHHHHHHHHcccHHHHHHHHHHHHHcccccccccHHHHHHHHHcHHHHHcccHHHccHHHHHHHHHHHHHHHHHHHHcccccccccEEEEcccccccccccHHHHHHHHHHHHHHHHHHHccccEEEEccHHHHHHHccHHHHcccEEEEEEEEcccccEEEEEEHHHHHHHHHHHHHHHcccccHHHHHcccccccEEcHHHccccccEEcc //