[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : ACD30316.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  9/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:181 amino acids
:PSIPRED
:HMM:PFM   9->56 PF11694 * DUF3290 0.0003 29.2 48/149  
:TM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD30316.1 GT:GENE ACD30316.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION 266776..267321 GB:FROM 266776 GB:TO 267321 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ACD30316.1 GB:DB_XREF GI:187712019 LENGTH 181 SQ:AASEQ MSLSLFRFILLYTVFKFFVMTMYSKKAKVFFSRKVIIVMLMTLLVTSCATDKYQARELPLLKHGYSKKNLTAYNIFGFCCDNTPSGIFNIIDKKPTEFLVNIYVGDNQGCKFIYAADTKGKQGEITQTGSFTAYLSGRNELLKLECKGKDSNIDYKVIAYANAIEYDRVGNLSYLVESGGL GT:EXON 1|1-181:0| TM:NTM 2 TM:REGION 2->23| TM:REGION 34->52| HM:PFM:NREP 1 HM:PFM:REP 9->56|PF11694|0.0003|29.2|48/149|DUF3290| OP:NHOMO 9 OP:NHOMOORG 9 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111111111---------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PSIPRED ccHHHHHHHHHHHHHHHHHHHHHccccEEEEHHHHHHHHHHHHHHHHccccccHHcccHHHHcccccccccEEEEEEEEEccccHHHHHHHcccccEEEEEEEEEcccccEEEEEEcccccccEEEEccEEEEEEEcccEEEEEEEccccccccEEEEEEEEccccccccccEEHHHcccc //