[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : ACD30323.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  265/915 : Eukaryota  6/199 : Viruses  0/175   --->[See Alignment]
c.69.1
:212 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   6->203 2fukA PDBj 1e-35 38.1 %
:RPS:PDB   10->194 3dd5C PDBj 2e-10 10.0 %
:RPS:SCOP  3->212 2fukA1  c.69.1.36 * 5e-12 31.7 %
:HMM:SCOP  5->208 1thtA_ c.69.1.13 * 1.7e-23 23.0 %
:RPS:PFM   63->138 PF02129 * Peptidase_S15 5e-07 32.9 %
:HMM:PFM   76->191 PF02230 * Abhydrolase_2 9e-08 23.9 113/216  
:HMM:PFM   45->85 PF12146 * Hydrolase_4 0.00028 22.5 40/79  
:BLT:SWISS 1->208 Y471_RICPR 2e-28 36.3 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD30323.1 GT:GENE ACD30323.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION 275100..275738 GB:FROM 275100 GB:TO 275738 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ACD30323.1 GB:DB_XREF GI:187712026 LENGTH 212 SQ:AASEQ MDTFFIQGQAGRIETAYDKVKGANKDIVAVICHPHPLYQGSMHNKIVTTIVRAMKTFNIESYRFNYRGVGESQGQYGDGVGELEDLISVCDWIKHNSTAKKIILCGFSFGGAIAYKGLSSLDNIVSLITIAPAVDRFDLTKFSQPQDIPWLVVQGIDDDTVNPNSVFDFTLKAIKSDLTLVKMNQVGHFFHGKLIELKTVIENFLTPIVDKL GT:EXON 1|1-212:0| BL:SWS:NREP 1 BL:SWS:REP 1->208|Y471_RICPR|2e-28|36.3|204/238| BL:PDB:NREP 1 BL:PDB:REP 6->203|2fukA|1e-35|38.1|194/218| RP:PDB:NREP 1 RP:PDB:REP 10->194|3dd5C|2e-10|10.0|180/193| RP:PFM:NREP 1 RP:PFM:REP 63->138|PF02129|5e-07|32.9|76/238|Peptidase_S15| HM:PFM:NREP 2 HM:PFM:REP 76->191|PF02230|9e-08|23.9|113/216|Abhydrolase_2| HM:PFM:REP 45->85|PF12146|0.00028|22.5|40/79|Hydrolase_4| GO:PFM:NREP 2 GO:PFM GO:0004177|"GO:aminopeptidase activity"|PF02129|IPR000383| GO:PFM GO:0006508|"GO:proteolysis"|PF02129|IPR000383| RP:SCP:NREP 1 RP:SCP:REP 3->212|2fukA1|5e-12|31.7|205/218|c.69.1.36| HM:SCP:REP 5->208|1thtA_|1.7e-23|23.0|196/0|c.69.1.13|1/1|alpha/beta-Hydrolases| OP:NHOMO 280 OP:NHOMOORG 271 OP:PATTERN -------------------------------------------------------------------- 111-----------------------------------------------------------------------------------------------------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111111111111111111111111111111111-111111111111111111111111111111111111111111111111111-11111111111--11111111111111111111111111111111111111111111111111111122221111111111111-111111---111111111111111-1-1--------------------1111--11-------------------------11---------------------------------------------------------------------------------------------------------------------------------1111111111-1------------------111111111111111111111222111111111111111--------------11111111111111----------------------------------------------------------- ------------11----------------------------------------------------------------------------------------------------------------------------------------------------------------1---13--------1---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 210 STR:RPRED 99.1 SQ:SECSTR EEEEEEEcTccccHHHHccTTccccEEEEEEEccTTccTTTcccHHHHHHHHHHHHHcGGGEEccTTccccGGGGGcTTcccHHHHHHHHHHHHHHcTTcEEEEEEETHHHHHHHHHHHTccHEEEEEEEccTTTTTTTTccTTccGGGGEEEEccTTcGGGGTcccccHHHccccccHHHHHTHHHHHHHHHHHHHHHHHHHHHHHHHH## PSIPRED ccEEEEEcccccEEEEEEccccccccEEEEEEccccccccccccHHHHHHHHHHHHcccEEEEEcccccccccccHHHHHHHHHHHHHHHHHHHHcccccEEEEEEEcHHHHHHHHHHcccccccEEEEEcccccccccccccccccccEEEEEccccccccHHHHHHHHHHHHccccEEEEEcccccccccHHHHHHHHHHHHHHHHHHcc //