[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : ACD30327.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  7/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:115 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   35->73 PF06929 * Rotavirus_VP3 0.00057 25.6 39/684  
:PROS 12->32|PS00409|PROKAR_NTER_METHYL
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD30327.1 GT:GENE ACD30327.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION 281655..282002 GB:FROM 281655 GB:TO 282002 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ACD30327.1 GB:DB_XREF GI:187712030 LENGTH 115 SQ:AASEQ MKARFSSTSKQRGLSLVESLISSGLILFVLLSSFLVINSVITTSVTVEKKFQLSQQLDKKIAQYILTGRFNDMAVGNSDFLQAKSSNSNLVKFVGIDRNFGIRVSKEVIKYGTTF GT:EXON 1|1-115:0| PROS 12->32|PS00409|PROKAR_NTER_METHYL|PDOC00342| TM:NTM 1 TM:REGION 20->42| SEG 19->47|slissglilfvllssflvinsvittsvtv| HM:PFM:NREP 1 HM:PFM:REP 35->73|PF06929|0.00057|25.6|39/684|Rotavirus_VP3| OP:NHOMO 7 OP:NHOMOORG 7 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-111111----------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 17-17,20-20,25-25,115-116| PSIPRED cccccccHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHcEEEHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHcccccccEEEEEEEcccccHHHHHHHHHHcccc //