[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : ACD30328.1
DDBJ      :             pilus assembly protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  8/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:206 amino acids
:PSIPRED
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD30328.1 GT:GENE ACD30328.1 GT:PRODUCT pilus assembly protein GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION 284318..284938 GB:FROM 284318 GB:TO 284938 GB:DIRECTION + GB:PRODUCT pilus assembly protein GB:PROTEIN_ID ACD30328.1 GB:DB_XREF GI:187712031 LENGTH 206 SQ:AASEQ MLKISAIFLVLIVSICNVYAANCQLIDAQNGSNGLVEFSCDQDVSLDDNKVIFYIVGKDVEIDSIKVSRGDIDFTIDQVTKNVKRVSLNIVKKTILDFELDYIAYRQQPVKLIIQAKKDSNLDYQILWGGVVKNSYTNTENNNNNFQFYITKSKLFVVKNGLECSIKGDCDANINILDRNDSPQATQLLQKLATYFDFGIVHQRLV GT:EXON 1|1-206:0| TM:NTM 1 TM:REGION 4->26| SEG 137->145|tntennnnn| OP:NHOMO 8 OP:NHOMOORG 8 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111111-1---------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PSIPRED ccEEHHHHHHHHHHHHHEEEccEEEEEcccccccEEEEEccccccccccEEEEEEEcccEEEEEEEEEcccEEEEHHHHHccccEEEHHEEEEEEEEEEEEEEEEccccEEEEEEEcccccccEEEEEEEEEEEEEEcccccccEEEEEEEccEEEEEEcccEEEEccccccccEEEEccccHHHHHHHHHHHHHHHHHHHHHHcc //