[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : ACD30338.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  7/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
b.1.14
:241 amino acids
:PSIPRED
:DISOPRED
:RPS:SCOP  18->104 1cwvA1  b.1.14.1 * 5e-04 20.7 %
:HMM:PFM   2->74 PF08603 * CAP_C 0.00018 26.0 73/159  
:BLT:SWISS 31->112 PROB_NOSP7 9e-04 24.4 %
:BLT:SWISS 157->227 YJCF_ECOLI 3e-04 31.4 %
:TM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD30338.1 GT:GENE ACD30338.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION 304236..304961 GB:FROM 304236 GB:TO 304961 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ACD30338.1 GB:DB_XREF GI:187712041 LENGTH 241 SQ:AASEQ MKVKKLVKSIFIASCSMISLSTIPSISYAEVSDIIEVNKQVINQNSTIITGKILPNDSYFIRDSNGNTILEGVSDSNGVFHKKVRGLDENDTLVLNYRGQSITAYNDGFMAIFKYKPHVLFASSPFDPPEYDDPSYWWGQAKNMQALFFQTTLGLFNIRQAYKEALISGKGMSWYQATNFENITLGLLSVGQGFYDAYKSQQATKETLEKLSKDFNESYSKIMKKLDWFVNNIDVEFSFNT GT:EXON 1|1-241:0| BL:SWS:NREP 2 BL:SWS:REP 31->112|PROB_NOSP7|9e-04|24.4|82/100| BL:SWS:REP 157->227|YJCF_ECOLI|3e-04|31.4|70/430| TM:NTM 1 TM:REGION 6->28| HM:PFM:NREP 1 HM:PFM:REP 2->74|PF08603|0.00018|26.0|73/159|CAP_C| RP:SCP:NREP 1 RP:SCP:REP 18->104|1cwvA1|5e-04|20.7|82/94|b.1.14.1| OP:NHOMO 9 OP:NHOMOORG 7 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------2111-112---------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 157-158,160-160,221-221,227-228,230-230,241-242| PSIPRED ccHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHccEEEEEEccccEEEEEcccccEEEEEEcccccEEEEEccccccccEEEEEEccEEEEEEEccEEEEEEEcccEEEcccccccccccccccccccccccEEEEEEHHHHHHHHHHHHHHHHHccccccEEEccccccEEEEEEHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccEEEEEEEcc //