[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : ACD30345.1
DDBJ      :             oxidoreductase
Swiss-Prot:             

Homologs  Archaea  6/68 : Bacteria  371/915 : Eukaryota  43/199 : Viruses  0/175   --->[See Alignment]
b.43.4c.25.1
:243 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   6->242 1tvcA PDBj 6e-16 28.0 %
:RPS:PDB   6->241 2bgiA PDBj 3e-36 19.7 %
:RPS:SCOP  4->102 1ep1B1  b.43.4.2 * 2e-15 19.6 %
:RPS:SCOP  112->242 1gvhA3  c.25.1.5 * 9e-24 13.0 %
:HMM:SCOP  4->108 2cndA1 b.43.4.2 * 8.3e-21 31.7 %
:HMM:SCOP  109->239 1jb9A2 c.25.1.1 * 1.1e-29 31.8 %
:RPS:PFM   9->105 PF00970 * FAD_binding_6 2e-07 34.4 %
:RPS:PFM   116->217 PF00175 * NAD_binding_1 4e-14 39.0 %
:HMM:PFM   116->219 PF00175 * NAD_binding_1 1.8e-20 32.4 102/109  
:HMM:PFM   8->103 PF00970 * FAD_binding_6 1.2e-14 30.5 95/99  
:BLT:SWISS 31->242 DMPP_PSEUF 2e-19 30.4 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD30345.1 GT:GENE ACD30345.1 GT:PRODUCT oxidoreductase GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION 317210..317941 GB:FROM 317210 GB:TO 317941 GB:DIRECTION + GB:PRODUCT oxidoreductase GB:PROTEIN_ID ACD30345.1 GB:DB_XREF GI:187712048 LENGTH 243 SQ:AASEQ MALEKFELELVSFKDITDKVRHFVFKRTDGKPLDFIAGQFITFLLTDEDGNIKRRSYSLGSLPADNMLLEIGMTYVEGGIATDTFFNMKVGDTAAAMGPAGRLVLKKDEEIRKLILVGTGTGIVPYRAMFPELLEKADNTEIHILLGVQYRKDALYQDDFIEFAKKHHNIHFKLCLSRETQDLRDYEISGYVQNQFDKIGLDPERDVVYVCGNPNMIDESYEMLTQAGFNAKNVRREKYISSN GT:EXON 1|1-243:0| BL:SWS:NREP 1 BL:SWS:REP 31->242|DMPP_PSEUF|2e-19|30.4|204/353| BL:PDB:NREP 1 BL:PDB:REP 6->242|1tvcA|6e-16|28.0|232/250| RP:PDB:NREP 1 RP:PDB:REP 6->241|2bgiA|3e-36|19.7|233/257| RP:PFM:NREP 2 RP:PFM:REP 9->105|PF00970|2e-07|34.4|96/99|FAD_binding_6| RP:PFM:REP 116->217|PF00175|4e-14|39.0|100/107|NAD_binding_1| HM:PFM:NREP 2 HM:PFM:REP 116->219|PF00175|1.8e-20|32.4|102/109|NAD_binding_1| HM:PFM:REP 8->103|PF00970|1.2e-14|30.5|95/99|FAD_binding_6| GO:PFM:NREP 4 GO:PFM GO:0016491|"GO:oxidoreductase activity"|PF00970|IPR008333| GO:PFM GO:0055114|"GO:oxidation reduction"|PF00970|IPR008333| GO:PFM GO:0016491|"GO:oxidoreductase activity"|PF00175|IPR001433| GO:PFM GO:0055114|"GO:oxidation reduction"|PF00175|IPR001433| RP:SCP:NREP 2 RP:SCP:REP 4->102|1ep1B1|2e-15|19.6|97/101|b.43.4.2| RP:SCP:REP 112->242|1gvhA3|9e-24|13.0|131/143|c.25.1.5| HM:SCP:REP 4->108|2cndA1|8.3e-21|31.7|104/114|b.43.4.2|1/1|Riboflavin synthase domain-like| HM:SCP:REP 109->239|1jb9A2|1.1e-29|31.8|129/154|c.25.1.1|1/1|Ferredoxin reductase-like, C-terminal NADP-linked domain| OP:NHOMO 776 OP:NHOMOORG 420 OP:PATTERN ---------------------------1-2--------------1----1----------------22 11-1----111----------1--12----------2-64--11--------11--------2-2-2-2----------------------1--------1--11212211--------------11--111-1-1----------111-11-11--11111-1111----111111111111----------1-----1-1-1111111-11-111-------------------------------1-----------1----------1----------------------------------------------------1--1---1--12-1-----111----1---------11-1-----------21--1-----1-213---2-111----------2-43124112----211-1-111111-4-11--21-11-32--------3---1----------------------------------1-1-233213333342444433244444245442545224435322-25432411312231222222222113761-11----------------------2--1-------------------------1-22-11221131141121112333324323234--1-1111-----11-------------------------------1--2-2-2-11121221221211-2-211---------222222222222--12-----111131223111-------1----3332323-2-515555253243433522211111111111323-----33122222222222211111---11--------------1-------------------------1-111-1------ ----1------------11-21-211--------------------11-1111-----------1----2--1-2------222-2-----------------1-----1-----2------2--1---------1-------------------211----12-----15-212----8----11-1-----1----- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 242 STR:RPRED 99.6 SQ:SECSTR cEEcTEEEEEEEEEEEETTEEEEEEEccTTccccccTTcEEEEEEEcTTccEEEEEEEccccTTccEEEEEcEEccTTcTTHHHHTTccTTcEEEEEEEEEccccGGGccccEEEEEEEGGGGHHHHHHTTcGGGGTcccEEEEEEEEcccGGGHHHHHHHHHHHHcTTTTTTcTTTEEEEccccccccccHHHHHHccHHcTTTEEEEEEEcHHHHHHHHHHHHTTTcccccTTccccEEc# DISOP:02AL 243-244| PSIPRED cccEEEEEEEEEEEEccccEEEEEEEcccccccccccccEEEEEEEcccccEEEEEEEcccccccccEEEEEEEEcccccHHHHHHHcccccEEEEEccccccccccccccccEEEEEccccHHHHHHHHHHHHHccccccEEEEEEEccHHHHccHHHHHHHHHHcccEEEEEEEcccccccccccEEEcHHHHHHHccccccccEEEEEccHHHHHHHHHHHHHccccHHHEEEEEEEEcc //