[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : ACD30367.1
DDBJ      :             ABC transporter, ATP-binding protein
Swiss-Prot:             

Homologs  Archaea  68/68 : Bacteria  908/915 : Eukaryota  197/199 : Viruses  0/175   --->[See Alignment]
c.37.1
:267 amino acids
:PSIPRED
:BLT:PDB   20->247 2yyzA PDBj 1e-34 30.8 %
:RPS:PDB   4->228 3b5jA PDBj 2e-40 22.2 %
:RPS:SCOP  4->244 1b0uA  c.37.1.12 * 2e-44 28.3 %
:HMM:SCOP  4->241 1g2912 c.37.1.12 * 9.3e-61 33.8 %
:RPS:PFM   43->167 PF00005 * ABC_tran 7e-24 45.8 %
:HMM:PFM   43->168 PF00005 * ABC_tran 3.1e-22 37.1 116/118  
:BLT:SWISS 4->249 Y1087_HAEIN 1e-64 49.4 %
:PROS 141->155|PS00211|ABC_TRANSPORTER_1

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD30367.1 GT:GENE ACD30367.1 GT:PRODUCT ABC transporter, ATP-binding protein GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION 345186..345989 GB:FROM 345186 GB:TO 345989 GB:DIRECTION + GB:PRODUCT ABC transporter, ATP-binding protein GB:PROTEIN_ID ACD30367.1 GB:DB_XREF GI:187712070 LENGTH 267 SQ:AASEQ MCDISFKNVSFYRDSRCIYDDITFTIPTNKITTILGPSGAGKTTILQLIAGLIKPTLGKICIDNAIIEKNTKETQLEKLRRRMGFLFQSGALFTHLSVYDNIAFPLRKNTNLDEKLIRNIVLLKLQAVGLAHTINMMPSELSGGMARRVALARSIAMDPDIMMYDEPFTGQDPASFNKLLELISTLNESLNMTSIIVSHDIQESLSISDHIIIVGNNKIIASDSPENIKNSKDQQIQNFLAGKPLDYNYHNHNDLEKNFFKKEILGR GT:EXON 1|1-267:0| BL:SWS:NREP 1 BL:SWS:REP 4->249|Y1087_HAEIN|1e-64|49.4|245/264| PROS 141->155|PS00211|ABC_TRANSPORTER_1|PDOC00185| BL:PDB:NREP 1 BL:PDB:REP 20->247|2yyzA|1e-34|30.8|221/358| RP:PDB:NREP 1 RP:PDB:REP 4->228|3b5jA|2e-40|22.2|221/243| RP:PFM:NREP 1 RP:PFM:REP 43->167|PF00005|7e-24|45.8|118/123|ABC_tran| HM:PFM:NREP 1 HM:PFM:REP 43->168|PF00005|3.1e-22|37.1|116/118|ABC_tran| GO:PFM:NREP 2 GO:PFM GO:0005524|"GO:ATP binding"|PF00005|IPR003439| GO:PFM GO:0016887|"GO:ATPase activity"|PF00005|IPR003439| RP:SCP:NREP 1 RP:SCP:REP 4->244|1b0uA|2e-44|28.3|240/258|c.37.1.12| HM:SCP:REP 4->241|1g2912|9.3e-61|33.8|237/240|c.37.1.12|1/1|P-loop containing nucleoside triphosphate hydrolases| OP:NHOMO 49147 OP:NHOMOORG 1173 OP:PATTERN SSMCSMHIYXXUXUaPnHTQKQMXyNQgnUfUJCDEEEHGGFDTZQXlJQ**g9UfSTYMRNKEb17A VYuO*cahnnrWbRXUVON-Nk99Z*OOOOOPupoqv***Q*c*o*ubrgdN***PShCCzxzh*tw***baZYY*cbdO*glCCEACVVSJ7OEIK--FFWJLIeMYMS8AAAAAACDDBBBBGTRLQXNMSTaRinn**MLK*ZuottfenbfTVLILHOEfdai***dKOFKLJMOJIGLgVXQQwlAXf*************************hr***ku***xwx**bnpqoqmlnooonnncjfcb*jbZ**ZOiZlvuPQ**fWSWmmjiktswwus**zyw*wwtsy*txydcdcbddegedba*ophghrpsms***********i*nu***fmnh*ylzz*hqTI**ylYbkpVcmeppQfcdNcUTTLNPMKOdY***ZQq****************-os*ik*m***VD**************MKL**********RQRRRRRRtYcIRnZ*6567777756579ACD89BBAA99A98B7MFEFEF***********xzy*v********j********BOwtqzjtnr******YnkOWJTkZIJIHIHIQPNbkie**ReWyjWpsecpLedaTSViWZVTUUowZ*LLLQIOOOPMIDDEFFEFEEHUHGIMLqruRuUjKUNyRUXZWRWbUSRVTWZWXea5-EIWSM331444*v**Y*xw***x***uw-*wwx*y*y*z***ssvsrv*****mnimmjkjmlmllkklkkk*olptttvS5************45KIEHEEFNNQOMM*r*edcaaaNRTQNWPUcPRTQRHTHOTqauuuvx***t**wwk***FGGEFGGFGJkrr*rssss*****RSRPPQPNOPEEEE88KXRRJKMM9989899A*DcFDCEE-EGHFLIETSPAGMEJHAABbn*YYq*trrFbO 2466bUG-eK8CPbRFADDAIKEKGLFBB9B8AJKIBLFHBFF999DGDJLIVOFDF8ADDD75845715649985724657776749-AE6A978887977BJFG3LQkhOWPYXdIJEAGSKpn7vE**l4mSuJHG9cCIhXDNGEBbE9*FSMOoKk*IfMb9*Xa*RbYOEFEE*DCBELoZh*B*pKFfVebR ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PSIPRED ccEEEEEEEEEEEccEEEEEccEEEEccccEEEEEccccccHHHHHHHHHccccccccEEEEccEEcccccccccccHHHccccEEEEcccccccccHHHHHHHHHHHHccccHHHHHHHHHHHHHHcccHHHHHccHHHcccHHHHHHHHHHHHHccccEEEEEcccccccHHHHHHHHHHHHHHHHHHccEEEEEEccHHHHHHHccEEEEEEccEEEEEccHHHHHccccHHHHHHHccccccccccccHHHHHHHHccccccc //