[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : ACD30370.1
DDBJ      :             conserved hypothetcial protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  90/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:220 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   53->183 2qguA PDBj 1e-08 29.8 %
:RPS:PDB   76->173 3dnmC PDBj 4e-04 7.1 %
:RPS:PFM   35->183 PF05494 * Tol_Tol_Ttg2 8e-18 39.2 %
:HMM:PFM   32->184 PF05494 * Tol_Tol_Ttg2 3.9e-25 27.5 149/170  
:BLT:SWISS 1->182 YRBC_SHIFL 4e-12 28.0 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD30370.1 GT:GENE ACD30370.1 GT:PRODUCT conserved hypothetcial protein GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION 347364..348026 GB:FROM 347364 GB:TO 348026 GB:DIRECTION + GB:PRODUCT conserved hypothetcial protein GB:PROTEIN_ID ACD30370.1 GB:DB_XREF GI:187712073 LENGTH 220 SQ:AASEQ MLRKISIFLSLIILMVSSAWAIENPVDMLNRTIVKTQDKLIKNANEYKQDPYKLLRLVDREIIPVVAPSVIAQLVVGTPKWKKATPAEQKQFIRSATEMLAFMYAKNVAYAGKYKLTLFPFNKNDTSWENKPIVIVNGKITNIDNDQSSDFAVKMFQKDGKWHVYDFDVAGVSILRTYQQQFAPYPNVVEMTKAVEKVTTKIKEKTYPKLLDKNYNLQSV GT:EXON 1|1-220:0| BL:SWS:NREP 1 BL:SWS:REP 1->182|YRBC_SHIFL|4e-12|28.0|175/211| TM:NTM 1 TM:REGION 5->27| SEG 192->206|tkavekvttkikekt| BL:PDB:NREP 1 BL:PDB:REP 53->183|2qguA|1e-08|29.8|121/178| RP:PDB:NREP 1 RP:PDB:REP 76->173|3dnmC|4e-04|7.1|98/291| RP:PFM:NREP 1 RP:PFM:REP 35->183|PF05494|8e-18|39.2|143/169|Tol_Tol_Ttg2| HM:PFM:NREP 1 HM:PFM:REP 32->184|PF05494|3.9e-25|27.5|149/170|Tol_Tol_Ttg2| OP:NHOMO 90 OP:NHOMOORG 90 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------1--------------------1--------------------1-------------------------------------------------------------1--1-------------------------------------11-1-1-111111111--1111111111111111111111-11-11111111111111111-11111111----------------------1111----------1-----1111-----------------------------1111111111111------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 129 STR:RPRED 58.6 SQ:SECSTR ####################################################HHHHHHHHHTGGGccHHHHHH##ccHHHHHHHHHHHHHTccTTcHHTTTccccTTEEEEEEEETTEEEEEEEETTccccEEEEEcccTTTcccTGGGHHHHHHHHHHHTcEEEEEccccTTHHHHHHHHHH##################################### PSIPRED ccHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHcHHHHcccHHHHHHHHHHHccccccHHHHHHHHHcccHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEEEcccccccccccEEEEEEEEEEcccccccEEEEEEEEccccEEEEEEEEccHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHcccccccccccccc //