[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : ACD30371.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  9/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.13.2
:97 amino acids
:SECSTR
:PSIPRED
:RPS:PDB   10->95 1auzA PDBj 2e-06 19.8 %
:RPS:SCOP  10->95 1th8B  c.13.2.1 * 2e-07 17.4 %
:HMM:SCOP  9->93 1vc1A_ c.13.2.1 * 1.2e-08 22.4 %
:HMM:PFM   13->83 PF01740 * STAS 1.8e-08 15.5 71/117  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD30371.1 GT:GENE ACD30371.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION 348026..348319 GB:FROM 348026 GB:TO 348319 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ACD30371.1 GB:DB_XREF GI:187712074 LENGTH 97 SQ:AASEQ MITVTNHKWTIETELTLKTVANIYRNFRKNLKKIDKTWIIDFARCDRIDSAGLSLIIEYIKYAQKNNIQIVFKNIDQKTLSLAKVHGAKTILEEYIN GT:EXON 1|1-97:0| RP:PDB:NREP 1 RP:PDB:REP 10->95|1auzA|2e-06|19.8|86/116| HM:PFM:NREP 1 HM:PFM:REP 13->83|PF01740|1.8e-08|15.5|71/117|STAS| RP:SCP:NREP 1 RP:SCP:REP 10->95|1th8B|2e-07|17.4|86/115|c.13.2.1| HM:SCP:REP 9->93|1vc1A_|1.2e-08|22.4|85/110|c.13.2.1|1/1|Anti-sigma factor antagonist SpoIIaa| OP:NHOMO 9 OP:NHOMOORG 9 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111111111---------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 86 STR:RPRED 88.7 SQ:SECSTR #########cccccccTTHHHHHHHHHHHHHcccccEEEEEccccccccTTHHHHHHHHHHHHHHHTccccEEcccTTTTHHHHHHccGGGTccc## PSIPRED cEEEEcccEEEEEEEcHHHHHHHHHHHHHHccccccEEEEEEcccEEEcHHHHHHHHHHHHHHHHcccEEEEEEccHHHHHHHHHHcHHHHHHHHcc //