[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : ACD30373.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  5/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:166 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   77->148 PF00689 * Cation_ATPase_C 0.00012 18.1 72/183  
:BLT:SWISS 17->123 MUTL_CLOBL 2e-04 34.3 %
:TM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD30373.1 GT:GENE ACD30373.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION 353138..353638 GB:FROM 353138 GB:TO 353638 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ACD30373.1 GB:DB_XREF GI:187712076 LENGTH 166 SQ:AASEQ MKKIIIWVLEQIIALLDKGKNKSNEYNYGNSNKGIQVVESMPIDNSVTNNISYGTPELEPNCQIIEEKILGSVFNWIYKPYIMMGTIIYILILVAEIVLYPRFEITIENTWSIIFFTPLVITMMFLLFLLSYEEYRFSVLSEIRKNDWCEDTRNQFVYKKINDEII GT:EXON 1|1-166:0| BL:SWS:NREP 1 BL:SWS:REP 17->123|MUTL_CLOBL|2e-04|34.3|105/100| TM:NTM 3 TM:REGION 4->18| TM:REGION 82->103| TM:REGION 111->131| HM:PFM:NREP 1 HM:PFM:REP 77->148|PF00689|0.00012|18.1|72/183|Cation_ATPase_C| OP:NHOMO 5 OP:NHOMOORG 5 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11-1--1-1---------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 17-18,20-20,39-39,45-46,48-48,53-53,67-67,73-74,76-76,81-82,87-87,90-90,95-95| PSIPRED ccHHHHHHHHHHHHHHHcccccccccccccccccEEHHHHcccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEEcccEEHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHccccc //