[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : ACD30384.1
DDBJ      :             hypothetical membrane protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  9/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:195 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   64->136 2capA PDBj 6e-04 15.9 %
:HMM:PFM   80->193 PF04354 * ZipA_C 6.4e-10 21.8 110/131  
:HMM:PFM   6->100 PF11845 * DUF3365 0.00023 16.7 78/185  
:BLT:SWISS 32->194 ZIPA_ACTPJ 3e-06 28.9 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD30384.1 GT:GENE ACD30384.1 GT:PRODUCT hypothetical membrane protein GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION 369497..370084 GB:FROM 369497 GB:TO 370084 GB:DIRECTION + GB:PRODUCT hypothetical membrane protein GB:PROTEIN_ID ACD30384.1 GB:DB_XREF GI:187712087 LENGTH 195 SQ:AASEQ MTLILALVLVLVVLIIIDLYRKSLRLKQVEILRNIEQNNAQELITQAKSFPEYAANIENVQQEYPLLRDGFLLLYFEAIEPIQVKDLATFLKYYGIKYTDDKAFQKVNYKDVIFSILPDNQEQEFSSATDGSVTGIIAVMNYRKLASMDYDVKTCYELMLDILEALAKAFHGTLMNEHKVRLTKKDKQNYLAAIL GT:EXON 1|1-195:0| BL:SWS:NREP 1 BL:SWS:REP 32->194|ZIPA_ACTPJ|3e-06|28.9|159/336| TM:NTM 1 TM:REGION 1->21| SEG 3->19|lilalvlvlvvliiidl| RP:PDB:NREP 1 RP:PDB:REP 64->136|2capA|6e-04|15.9|69/376| HM:PFM:NREP 2 HM:PFM:REP 80->193|PF04354|6.4e-10|21.8|110/131|ZipA_C| HM:PFM:REP 6->100|PF11845|0.00023|16.7|78/185|DUF3365| OP:NHOMO 9 OP:NHOMOORG 9 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111111111---------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 69 STR:RPRED 35.4 SQ:SECSTR ###############################################################cccEEEEEEEEEcccccHHHHHHHHHHHHHH###TccccccHHH#HHHTTcccccHHHHHHHHHHHTcTTcTT########################################################### DISOP:02AL 39-39,45-46,48-48,53-53,115-115,118-118,123-124,129-130,132-132,137-137,165-165,171-171| PSIPRED cHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHcccHHHccHHHHHHHcHHHHccHHHHHHHHccccHHHHHHHHHHHHccccccHHHHHHccHHHHHHHHcccccHHHHHHcccccHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEHHHHHHHHHHHc //