[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : ACD30401.1
DDBJ      :             hypothetical membrane protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  9/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:133 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   24->127 PF01040 * UbiA 0.00017 22.7 97/258  
:BLT:SWISS 2->64 UPPP_BORHD 1e-04 34.4 %
:TM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD30401.1 GT:GENE ACD30401.1 GT:PRODUCT hypothetical membrane protein GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION 393958..394359 GB:FROM 393958 GB:TO 394359 GB:DIRECTION + GB:PRODUCT hypothetical membrane protein GB:PROTEIN_ID ACD30401.1 GB:DB_XREF GI:187712104 LENGTH 133 SQ:AASEQ MYEEQFLAEKLQQFSLLDIALVKIVYFLVGLLVATNYIVLTSVSWIFYLLMFLIAVFPIVIHLFSFEGSYIQKARKYLKTNKPSYQVLLFFSMFFFACTLAVLIPALSLVPWYVYLILIVIFAIKPMRSNMFW GT:EXON 1|1-133:0| BL:SWS:NREP 1 BL:SWS:REP 2->64|UPPP_BORHD|1e-04|34.4|61/100| TM:NTM 3 TM:REGION 14->36| TM:REGION 45->67| TM:REGION 95->117| HM:PFM:NREP 1 HM:PFM:REP 24->127|PF01040|0.00017|22.7|97/258|UbiA| OP:NHOMO 9 OP:NHOMOORG 9 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111111111---------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 45-45,101-102,104-104,109-109,133-134| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHcccc //