[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : ACD30423.1
DDBJ      :             10 TMS drug/metabolite exporter protein
Swiss-Prot:             

Homologs  Archaea  12/68 : Bacteria  138/915 : Eukaryota  3/199 : Viruses  0/175   --->[See Alignment]
f.39.1
:294 amino acids
:PSIPRED
:HMM:SCOP  40->144 1s7bA_ f.39.1.1 * 3.8e-08 23.8 %
:HMM:SCOP  188->292 1s7bA_ f.39.1.1 * 5.6e-10 21.0 %
:HMM:PFM   16->135 PF00892 * EamA 2.4e-15 23.3 120/126  
:HMM:PFM   191->283 PF00892 * EamA 5.7e-13 26.1 92/126  
:HMM:PFM   149->172 PF04999 * FtsL 0.00034 37.5 24/97  
:BLT:SWISS 7->285 Y788_ARCFU 6e-20 28.9 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD30423.1 GT:GENE ACD30423.1 GT:PRODUCT 10 TMS drug/metabolite exporter protein GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION complement(431555..432439) GB:FROM 431555 GB:TO 432439 GB:DIRECTION - GB:PRODUCT 10 TMS drug/metabolite exporter protein GB:PROTEIN_ID ACD30423.1 GB:DB_XREF GI:187712126 LENGTH 294 SQ:AASEQ MSIQRKAILALFIVTIFWGVTFPLIKISLAYISPGLFVAIRLSLSCLLFLPLILRAKFNNKLYLLKVGAIFGSLEGLSFYFQTHGLYTVSSSQSAFLTALSVVMIPFIGSLFKVDRLTIYGIIASCVSLIGIYALSGASFDNFTIGYLWSVLCALMYAVSVVYLSYETRKDHRSEAFRDLRLLIILQIAFGIPLPLITDISSFMYLHFNYILIIALTFCAISTITCYYLQNTYQKHLSMSQVAVIFSFEPIFATIFGKLINNEKIYLSTIIGGTLILTSYFIIEIGNRKRQSKP GT:EXON 1|1-294:0| BL:SWS:NREP 1 BL:SWS:REP 7->285|Y788_ARCFU|6e-20|28.9|263/308| TM:NTM 10 TM:REGION 7->29| TM:REGION 34->55| TM:REGION 58->80| TM:REGION 93->115| TM:REGION 117->139| TM:REGION 145->166| TM:REGION 179->201| TM:REGION 207->229| TM:REGION 237->259| TM:REGION 265->287| SEG 40->55|irlslscllflplilr| HM:PFM:NREP 3 HM:PFM:REP 16->135|PF00892|2.4e-15|23.3|120/126|EamA| HM:PFM:REP 191->283|PF00892|5.7e-13|26.1|92/126|EamA| HM:PFM:REP 149->172|PF04999|0.00034|37.5|24/97|FtsL| HM:SCP:REP 40->144|1s7bA_|3.8e-08|23.8|105/106|f.39.1.1|1/2|Multidrug resistance efflux transporter EmrE| HM:SCP:REP 188->292|1s7bA_|5.6e-10|21.0|105/106|f.39.1.1|2/2|Multidrug resistance efflux transporter EmrE| OP:NHOMO 171 OP:NHOMOORG 153 OP:PATTERN --1-1------------------1-------------------------------111111111---- -11-----------------------------------------------------------1------------1111-1---------------1----1-------------------------------------------------------------------1------------------21--1-111112111111211------212---2---------1----------------------------1-----11-------------------------------------------------------1112-----------11441----1--1---11-1-1-11-1-11-1-21-------11111----------------1---11----------------11-1-------------------------------------------------------------------------1------------------------------------------1----------------------------1------1------2-21-1--1---------1111----------------11----11----1---------1-------------------------------1-------------------------------1-----------------------1-------------------------11-11------------------------11111------------111-1111-111111111111--------------1-----------------111--11--------1---------------------------1111111212--- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------11----- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHcccccccccc //