[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : ACD30427.1
DDBJ      :             hypothetical membrane protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  8/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:204 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   15->99 PF05072 * Herpes_UL43 0.00043 26.2 84/373  
:PROS 66->76|PS00664|VINCULIN_2
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD30427.1 GT:GENE ACD30427.1 GT:PRODUCT hypothetical membrane protein GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION 437695..438309 GB:FROM 437695 GB:TO 438309 GB:DIRECTION + GB:PRODUCT hypothetical membrane protein GB:PROTEIN_ID ACD30427.1 GB:DB_XREF GI:187712130 LENGTH 204 SQ:AASEQ MITLGYVIYDCIANASILIFAFLLYKKNNYAWLFVLASLIIKVFIYGKYGISTSLIYLSAQLLTAILAAIIWLRNPTYVKVSKQKKLLVIVIALIILAIWIGLMYQYVNPYILNYELLFGFDYLCYMLVVIGGVFLIFRLAVGLLFFSVVYISYAVNYANSAMVIQNAPQYYRDFILYYWLSALFLFIAGIIIVATYTNAKRSV GT:EXON 1|1-204:0| PROS 66->76|PS00664|VINCULIN_2|PDOC00568| TM:NTM 6 TM:REGION 3->24| TM:REGION 32->54| TM:REGION 57->79| TM:REGION 87->109| TM:REGION 123->145| TM:REGION 176->198| SEG 58->73|lsaqlltailaaiiwl| SEG 87->99|llvivialiilai| HM:PFM:NREP 1 HM:PFM:REP 15->99|PF05072|0.00043|26.2|84/373|Herpes_UL43| OP:NHOMO 8 OP:NHOMOORG 8 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111111-11---------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 17-17,25-25,31-31,59-59,62-62,109-109,115-116,118-118,123-123,165-165,171-172,174-174,179-180,185-186,188-188| PSIPRED cEEHHHHHHHHHcccHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHccccEEEEccccHHHHHHHHHHHHHHHHHHHHHHccHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEEcccHHHHHHHHHHHHHHHHHHHHHHHHHEEEccccccc //