[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : ACD30438.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  9/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:130 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   44->103 PF11563 * Protoglobin 0.00073 21.4 56/196  
:TM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD30438.1 GT:GENE ACD30438.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION 451120..451512 GB:FROM 451120 GB:TO 451512 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ACD30438.1 GB:DB_XREF GI:187712141 LENGTH 130 SQ:AASEQ MRLLILFIAVMFSFDSYATIYEKYQNGVPEFSNQQSQGAKQLNLSDNPVSVIDMNSIPHTIVWGRAQQQYLPYSQPQEDTLQGAFPEEFTDNYFDFYGRNYQYHSLMSSTMGVSMYAPFGANNMRLQRNY GT:EXON 1|1-130:0| TM:NTM 1 TM:REGION 1->23| HM:PFM:NREP 1 HM:PFM:REP 44->103|PF11563|0.00073|21.4|56/196|Protoglobin| OP:NHOMO 9 OP:NHOMOORG 9 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111111111---------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 130-131| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccEEcccccccEEEEEccccccEEEEEcccHHccccccccHHHHccccHHHHHccHHHHHccccHHHHHHHHHccEEEEEccccccEEEEccc //